Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.57
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.431 0.000
lung cancer 1.800 0.000
ovarian cancer 1.200 0.005

Synonym

Accession P14649
Symbols MLC1SA

Gene

PDB

1OE9   1W7I   1W7J  

Gene RIF (2)

PMID Text
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain
18587628 Only the first IQ motif of IQGAP1 interacts with MYL6B. The first and second IQ motifs of IQGAP1 interact with S100B in the presence of calcium ions.

AA Sequence

MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFK      1 - 70
EAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQ     71 - 140
GTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV      141 - 208
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21299499 2011 IQ-motif selectivity in human IQGAP2 and IQGAP3: binding of calmodulin and myosin essential light chain.
21269460 2011 Initial characterization of the human central proteome.
18587628 2008 IQ motif selectivity in human IQGAP1: binding of myosin essential light chain and S100B.
15510214 2004 Three myosin V structures delineate essential features of chemo-mechanical transduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14627618 2003 Smooth muscle contraction and relaxation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
More...