Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.69
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Keloid 37 0.0 0.0
Disease Target Count P-value
lung cancer 4740 1.6e-05
acute quadriplegic myopathy 1158 2.8e-05
ovarian cancer 8520 4.6e-03

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.431 2.8e-05
lung cancer 1.800 1.6e-05
ovarian cancer 1.200 4.6e-03

Synonym

Accession P14649
Symbols MLC1SA

Gene

PDB

1OE9   1W7I   1W7J  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFK      1 - 70
EAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQ     71 - 140
GTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV      141 - 208
//

Text Mined References (14)

PMID Year Title