Property Summary

Ligand Count 1
NCBI Gene PubMed Count 271
PubMed Score 1189.27
PubTator Score 878.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma 3.496 6.2e-08
adult high grade glioma 1.200 1.6e-02
astrocytic glioma -1.400 1.2e-02
Atopic dermatitis 2.200 1.2e-04
atypical teratoid / rhabdoid tumor 2.100 5.0e-08
Breast cancer 2.200 2.2e-14
breast carcinoma 1.400 2.0e-05
colon cancer 2.500 2.7e-02
ductal carcinoma in situ 2.100 1.3e-03
Endometriosis 1.587 1.6e-02
glioblastoma 2.100 1.4e-07
group 3 medulloblastoma 3.100 3.3e-07
intraductal papillary-mucinous adenoma (... 1.300 4.6e-02
intraductal papillary-mucinous carcinoma... 2.200 6.8e-05
intraductal papillary-mucinous neoplasm ... 3.000 1.5e-04
invasive ductal carcinoma 2.700 2.0e-04
lung adenocarcinoma 1.200 2.2e-09
lung cancer 3.900 2.2e-05
medulloblastoma, large-cell 2.600 1.3e-07
nasopharyngeal carcinoma 1.300 2.1e-03
non-small cell lung cancer 3.907 1.9e-38
ovarian cancer 1.600 1.7e-03
pancreatic cancer 2.163 4.2e-02
pituitary cancer 1.300 4.0e-05
posterior fossa group A ependymoma 1.300 6.2e-04
primary Sjogren syndrome 1.300 5.3e-03
primitive neuroectodermal tumor 2.200 5.0e-05
psoriasis 1.800 2.3e-06
ulcerative colitis 1.200 1.2e-03

Protein-protein Interaction (1)

Gene RIF (215)

AA Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSA      1 - 70
TGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE     71 - 140
DLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLV    141 - 210
QVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKH    211 - 280
QIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFC    281 - 350
LALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS    351 - 420
ALVQDLAKAVAKV                                                             421 - 433
//

Text Mined References (276)

PMID Year Title