Property Summary

NCBI Gene PubMed Count 261
Grant Count 256
R01 Count 157
Funding $28,864,763.53
PubMed Score 1121.35
PubTator Score 878.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14635 A8K066 Q5TZP9
Symbols CCNB

Gene

PDB

2B9R   2JGZ   4Y72   4YC3   5HQ0  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1414 confirmatory 7 / 0 / 31 Counterscreen assay for inhibitors of Wee1 degradation: dose response cell-based assay to identify inhibitors of cyclin B degradation
463186 other 0 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of Wee1 degradation: luminescence-based cell-based assay to identify inhibitors of cyclin B degradation
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (221)

PMID Text
26942677 CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription.
26834014 Together, these results demonstrate that PGC-1alpha regulates cell cycle progression through modulation of CyclinD1 and CyclinB1 by ATP and ROS.
26709398 exposing renal carcinoma cells to amygdalin inhibited cell cycle progression and tumor cell growth by impairing cdk1 and cyclin B expression
26706989 On analyzing cyclin A and B1 (CCNA and CCNB1) expression, positive staining in 90% cases of PTC were observed. The study revealed a significant difference in expression of cyclins A and B1 between classic and non-classic variants of PTC.
26555773 Our results demonstrate for the first time that the SYSADOA diacerein decreased the viability of human chondrosarcoma cells and induces G2/M cell cycle arrest by CDK1/cyclin B1 down-regulation.
26555753 Sodium butyrate accelerates 3' UTR-dependent cyclin B1 decay by enhancing the binding of tristetraprolin to the 3' untranslated region of cyclin B1.
26506418 Data suggest that long non-coding RNA ZFAS1 may function as oncogene via destabilization of tumor suppressor protein p53 (p53) and through cyclin-dependent kinase 1 (CDK1)/cyclin B1 complex leading to cell cycle progression and inhibition of apoptosis.
26349943 Proximity ligation assay demonstrate proximity between S100A4 and cyclin B1 in vitro, while confocal microscopy showed S100A4 to localize to areas corresponding to centrosomes in mitotic cells prior to chromosome segregation.
26270673 The authors postulate that the mechanism of cytomegalovirus pUL97-human cyclin B1 interaction is determined by an active pUL97 kinase domain.
26136431 that CCNB1 contained many CD4 T cell epitopes, which are differentially recognized by pre-existing naive and memory CD4 T cells.
More...

AA Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSA      1 - 70
TGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE     71 - 140
DLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLV    141 - 210
QVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKH    211 - 280
QIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFC    281 - 350
LALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS    351 - 420
ALVQDLAKAVAKV                                                             421 - 433
//

Text Mined References (266)

PMID Year Title
26942677 2016 CDK1-Cyclin B1 Activates RNMT, Coordinating mRNA Cap Methylation with G1 Phase Transcription.
26834014 2016 PGC-1? regulates the cell cycle through ATP and ROS in CH1 cells.
26709398 2016 Amygdalin inhibits the growth of renal cell carcinoma cells in vitro.
26706989 2015 Patterns of cyclin A and B1 immunostaining in papillary thyroid carcinoma.
26555773 2015 Diacerein retards cell growth of chondrosarcoma cells at the G2/M cell cycle checkpoint via cyclin B1/CDK1 and CDK2 downregulation.
26555753 2015 Sodium butyrate down-regulates tristetraprolin-mediated cyclin B1 expression independent of the formation of processing bodies.
26506418 2016 Long non-coding RNA ZFAS1 interacts with CDK1 and is involved in p53-dependent cell cycle control and apoptosis in colorectal cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26349943 2015 Enrichment of nuclear S100A4 during G2/M in colorectal cancer cells: possible association with cyclin B1 and centrosomes.
26270673 2015 The Interaction between Cyclin B1 and Cytomegalovirus Protein Kinase pUL97 is Determined by an Active Kinase Domain.
More...