Property Summary

NCBI Gene PubMed Count 151
Grant Count 336
R01 Count 204
Funding $41,086,382.41
PubMed Score 604.48
PubTator Score 378.72

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14625 Q96A97
Symbols ECGP
GP96
TRA1
GRP94
HEL35
HEL-S-125m

Gene

PANTHER Protein Class (2)

PDB

4NH9  

Gene RIF (104)

PMID Text
27046189 These results demonstrated the pivotal role of HSP90B1 in the proliferation and survival of ovarian cells, suggesting a critical role for HSP90B1 in the pathogenesis of PCOS.
26945068 This study clarifies a Grp94-mediated ERAD pathway for GABAA receptors, which provides a novel way to finely tune their function in physiological and pathophysiological conditions.
26872972 GRP94 knockdown cells are defective in intracellular transport and, consequently, negatively impact the trafficking of F-actin toward the cellular cortex, integrin alpha2 and integrin alphaL toward the cell membrane and filopodia
26719248 The authors showed that hepatitis C virus E2 protein triggers the production of TGF-beta1 by hepatitis C virus-infected cells through overproduction of glucose-regulated protein 94 (GRP94).
26497551 Results indicate that FN14 and GRP94 are prediction/prognosis markers which open up new possibilities for preventing/treating brain metastasis in breast cancer patients.
26464709 Our results indicate that GRP94 and TRAP1 might contribute more to the carcinogenesis or biology of SCLC than HSP90alpha and HSP90beta
26339394 Hsp90-beta protein was over-expressed in lung adenocarcinoma tissues and was associated with poor outcomes in early stage tumors and low pathological grade tumors.
26235316 data suggest a role of infection-induced Gp96 shedding in the protection of the chlamydial replicative niche
26167512 Grp94 was detected in plasma of type 1 diabetic but not control subjects and found linked with its N-terminus to the IgG heavy chain.
26115722 High HSP90B1 expression is associated with bone metastasis in renal cell carcinoma.
More...

AA Sequence

MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELR      1 - 70
EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDK     71 - 140
EKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVI    141 - 210
VTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIY    211 - 280
VWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEV    281 - 350
EEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD    351 - 420
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGT    421 - 490
NIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLK    491 - 560
KGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDK    561 - 630
IEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRR    631 - 700
IKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDT    701 - 770
TEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL                                         771 - 803
//

Text Mined References (162)

PMID Year Title
27046189 2016 The Role of Heat Shock Protein 90B1 in Patients with Polycystic Ovary Syndrome.
26945068 2016 Grp94 Protein Delivers ?-Aminobutyric Acid Type A (GABAA) Receptors to Hrd1 Protein-mediated Endoplasmic Reticulum-associated Degradation.
26872972 2016 Endoplasmic Reticulum-resident Heat Shock Protein 90 (HSP90) Isoform Glucose-regulated Protein 94 (GRP94) Regulates Cell Polarity and Cancer Cell Migration by Affecting Intracellular Transport.
26719248 2015 New Mechanism of Hepatic Fibrogenesis: Hepatitis C Virus Infection Induces Transforming Growth Factor ?1 Production through Glucose-Regulated Protein 94.
26497551 2015 FN14 and GRP94 expression are prognostic/predictive biomarkers of brain metastasis outcome that open up new therapeutic strategies.
26464709 2015 Differential expression of heat shock protein 90 isoforms in small cell lung cancer.
26339394 2015 Heat shock protein 90-? over-expression is associated with poor survival in stage I lung adenocarcinoma patients.
26235316 2015 Chlamydia-infected cells shed Gp96 to prevent chlamydial re-infection.
26167512 2015 Proteomic Investigation on Grp94-IgG Complexes Circulating in Plasma of Type 1 Diabetic Subjects.
26115722 2015 Eight proteins play critical roles in RCC with bone metastasis via mitochondrial dysfunction.
More...