Property Summary

Ligand Count 12
NCBI Gene PubMed Count 288
PubMed Score 1424.21
PubTator Score 447.47

Knowledge Summary

Patent (72,928)

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma 1.071 2.7e-03
adrenocortical carcinoma 2.004 1.1e-04
astrocytoma 1.500 2.5e-02
atypical teratoid / rhabdoid tumor 1.800 3.1e-06
breast carcinoma 1.100 4.7e-02
dermatomyositis -2.500 3.6e-04
ductal carcinoma in situ 1.400 3.9e-04
ependymoma 2.200 4.1e-03
glioblastoma 1.900 6.4e-05
group 4 medulloblastoma 1.200 3.4e-02
interstitial lung disease 1.100 3.5e-03
intraductal papillary-mucinous carcinoma... 1.900 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.3e-03
invasive ductal carcinoma 1.400 3.1e-04
lung adenocarcinoma 1.300 5.9e-08
lung cancer 1.800 2.3e-03
medulloblastoma, large-cell 1.600 8.6e-06
non-small cell lung cancer 1.284 1.4e-19
oligodendroglioma 1.600 3.7e-03
osteosarcoma -1.580 1.6e-03
ovarian cancer 1.500 1.0e-03
pancreatic cancer 1.500 6.0e-06
pancreatic ductal adenocarcinoma liver m... 2.954 6.1e-03
psoriasis -1.400 6.4e-04
Rheumatoid arthritis -1.300 4.4e-02
ulcerative colitis 1.400 7.8e-07

Gene RIF (235)

AA Sequence

MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN      1 - 70
VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL     71 - 140
KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN    141 - 210
LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF    211 - 280
DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN    281 - 350
AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS    351 - 420
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV    421 - 490
NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP                                 491 - 531
//

Text Mined References (309)

PMID Year Title