Property Summary

NCBI Gene PubMed Count 113
PubMed Score 554.82
PubTator Score 267.44

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (80)

AA Sequence

MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR      1 - 70
IIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL     71 - 140
MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL    141 - 210
EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL    211 - 280
QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL    281 - 350
EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV                                  351 - 390
//

Text Mined References (122)

PMID Year Title