Property Summary

NCBI Gene PubMed Count 104
Grant Count 339
R01 Count 224
Funding $25,270,864.28
PubMed Score 539.00
PubTator Score 267.44

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14598 A6NEH2 A8K7S9 O43842 Q2PP07 Q53FR5 Q9BU90 Q9BXI7 Q9BXI8 Q9UDV9 Q9UMU2 NCF-1
Symbols NCF1A
NOXO2
p47phox
SH3PXD1A

Gene

PDB

1WLP   1GD5   1K4U   1KQ6   1NG2   1O7K   1OV3   1UEC   1W70  

Gene RIF (73)

PMID Text
26728380 Data show that diphenylene iodonium (DPI) and apocynin can reduce hyperoxia-induced reactive oxygen species (ROS) production by decreasing the translocation and level of NADPH Oxidase p47phox.
26460255 A rare mutation in NCF1 encoding p47phox of the leukocyte NADPH oxidase causes lack of superoxide generation, leads to chronic granulomatous disease and was recently (1200-2300 years ago) introduced into the Kavkazi Jewish population
26317224 increased levels of gp91phox, p47phox and p22phox likely account for the interferon-gamma mediated enhancement of dimethyl sulfoxide-induced Nox2 activity.
25981738 DCLRE1C and NCF1 mutations have been found by whole-genome sequencing to cause primary immunodeficiency in unrelated patients.
25877926 TLR8, but not TLR7, is involved in priming of human neutrophil reactive oxygen species production by inducing the phosphorylation of p47phox and p38 MAPK.
25761062 Results identifies p47phox-dependent NADPH oxidase activity as a critical component of Angpt-1-mediated endothelial barrier defense against classic inflammatory permeability factors.
25239440 Reduced carotid but not coronary artery atherosclerosis in patients with chronic granulomatous disease despite the high prevalence of traditional risk factors raises questions about the role of NADPH oxidase in the pathogenesis of atherosclerosis.
24967690 Suggest eupafolin attenuated COX-2 expression leading to reduced production of prostaglandin E2 by blocking Nox2/p47(phox) pathway.
24596025 Four novel mutations in the NCF1, NCF2, and CYBB genees have been identified in chronic granulomatous disease patients in Morocco.
24126171 Williams syndrome patients are at risk for increased aortic stiffness. This vascular stiffness is caused by elastin insufficiency and is modified by NCF1 copy number.
More...

AA Sequence

MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR      1 - 70
IIPHLPAPKWFDGQRAAENRQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL     71 - 140
MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL    141 - 210
EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL    211 - 280
QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL    281 - 350
EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV                                  351 - 390
//

Text Mined References (114)

PMID Year Title
27040869 2016 Novel PKC-? to p47 phox interaction is necessary for transformation from blebbishields.
26728380 2016 [Diphenylene iodonium and apocynin reduce the translocation and level of p47phox in PBMCs of premature infants to inhibit reactive oxygen species production].
26460255 2015 A founder effect for p47(phox)Trp193Ter chronic granulomatous disease in Kavkazi Jews.
26317224 2015 INF-? Enhances Nox2 Activity by Upregulating phox Proteins When Applied to Differentiating PLB-985 Cells but Does Not Induce Nox2 Activity by Itself.
25981738 2015 Clinical application of whole-genome sequencing in patients with primary immunodeficiency.
25877926 2015 TLR8, but not TLR7, induces the priming of the NADPH oxidase activation in human neutrophils.
25761062 2015 Angiopoietin-1 requires oxidant signaling through p47phox to promote endothelial barrier defense.
25239440 2014 Assessment of atherosclerosis in chronic granulomatous disease.
24967690 2014 Eupafolin inhibits PGE2 production and COX2 expression in LPS-stimulated human dermal fibroblasts by blocking JNK/AP-1 and Nox2/p47(phox) pathway.
24596025 2014 Chronic granulomatous disease in Morocco: genetic, immunological, and clinical features of 12 patients from 10 kindreds.
More...