Property Summary

NCBI Gene PubMed Count 174
Grant Count 393
R01 Count 252
Funding $39,905,276.84
PubMed Score 723.71
PubTator Score 1041.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14555 A8K5I7 Q6DN24 Q6IBD9 Q9UCD2
Symbols MOM1
PLA2
PLA2B
PLA2L
PLA2S
PLAS1
sPLA2

Gene

PANTHER Protein Class (3)

PDB

1AYP   1BBC   1DB4   1DB5   1DCY   1J1A   1KQU   1KVO   1N28   1N29   1POD   1POE   2GNY   3U8B   3U8D   3U8H   3U8I   5G3N  

 MGI Term (1)

Gene RIF (140)

PMID Text
26644377 IL-22 induced at an early stage of L. monocytogenes infection enhances innate immunity against L. monocytogenes in the liver by stimulating hepatocytes to produce PLA2G2A
26506412 These results suggest that the genetic ablation of iPLA2b increased iron uptake in the brain through the activation of IRP2 and upregulation of DMT1, which may be associated with mitochondrial dysfunction.
26488172 Overexpression of sPLA2-IIA does not alter MCP-1 level at baseline, but could enhance the atherogenic effect of oxidized LDL in HASMCs, at least partly due to activation of Akt.
26106157 Results indicate that secreted phospholipase A2 IIA (sPLA2-IIA) as an enzyme working in concert with platelet microparticles (MPs) 12-lipoxygenase (12-LO) to promote internalization.
25794429 The minor allele of rs11573156, is a dominant haplotype and is associated with the higher sPLA2-IIa levels.
25713085 Activity of iPLbeta correlates inversely with the hydrophobicity of the phospholipid substrate.
25429648 sPLA2 are secreted from ciliated cells and appear to induce mucin and cysLT secretion from goblet cells, strongly suggesting that airway goblet cells are proinflammatory effector cells.
25422234 Co-expression of PLA2G2A and COX-2 significantly correlated with the depth of invasion (p=0.004)and with TNM stage (p=0.04) of esophageal squamous cell carcinoma
25398877 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrin alphaVbeta3, integrin alphavbeta1, and integrin alpha4beta1.
25366587 PLA2G2A was detected in all samples of endometriomas, but not in normal endometrium, and immunohistochemistry showed PLA2G2A-specific staining in epithelial cells of endometrioma paraffin sections.
More...

AA Sequence

MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC      1 - 70
YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS     71 - 140
TPRC                                                                      141 - 144
//

Text Mined References (176)

PMID Year Title
26644377 2015 Interleukin-22-Induced Antimicrobial Phospholipase A2 Group IIA Mediates Protective Innate Immunity of Nonhematopoietic Cells against Listeria monocytogenes.
26506412 2015 Deficiency of Calcium-Independent Phospholipase A2 Beta Induces Brain Iron Accumulation through Upregulation of Divalent Metal Transporter 1.
26488172 2015 sPLA2-IIA Augments Oxidized LDL-Induced MCP-1 Expression in Vitro Through Activation of Akt.
26106157 2015 Platelet microparticles are internalized in neutrophils via the concerted activity of 12-lipoxygenase and secreted phospholipase A2-IIA.
25794429 2015 The association of PLA2G2A single nucleotide polymorphisms with type IIa secretory phospholipase A2 level but not its activity in patients with stable coronary heart disease.
25713085 2015 Substrate efflux propensity is the key determinant of Ca2+-independent phospholipase A-? (iPLA?)-mediated glycerophospholipid hydrolysis.
25429648 2015 Secretory phospholipases A2 are secreted from ciliated cells and increase mucin and eicosanoid secretion from goblet cells.
25422234 2014 Overexpression of phospholipase A2 Group IIA in esophageal squamous cell carcinoma and association with cyclooxygenase-2 expression.
25398877 2015 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins ?v?3, ?4?1, and ?5?1.
25366587 2015 Phospholipase A2 group IIA is elevated in endometriomas but not in peritoneal fluid and serum of ovarian endometriosis patients.
More...