Property Summary

NCBI Gene PubMed Count 40
Grant Count 25
R01 Count 7
Funding $2,630,862.94
PubMed Score 128.84
PubTator Score 1228.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 0.002
glioblastoma 1.500 0.000
acute quadriplegic myopathy 1.124 0.000
tuberculosis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.169 0.004
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.700 0.000
Breast cancer 1.100 0.000

Gene RIF (13)

PMID Text
23747692 prostaglandin F synthase activity of human and bovine aldo-keto reductases
23643085 AKR1A1 could be involved in the metabolism of 4-hydroxynonenal and play a role in the resistance to oxidative stress
21276435 AKR1A1 has little effect on the production of gamma-hydroxybutyrate
20453000 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19423521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18495158 the binding site residues deviating between ALR1 and ALR2 influence ligand affinity in a complex interplay, presumably involving changes of dynamic properties and differences of the solvation/desolvation balance upon ligand binding
More...

AA Sequence

MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV      1 - 70
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY     71 - 140
KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY    141 - 210
SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT    211 - 280
FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY                             281 - 325
//

Text Mined References (49)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23747692 2013 Evaluation of the prostaglandin F synthase activity of human and bovine aldo-keto reductases: AKR1A1s complement AKR1B1s as potent PGF synthases.
23643085 2013 [Effect of AKR1A1 knock-down on H2;O2; and 4-hydroxynonenal-induced cytotoxicity in human 1321N1 astrocytoma cells].
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21276435 2011 The role of aldehyde reductase AKR1A1 in the metabolism of ?-hydroxybutyrate in 1321N1 human astrocytoma cells.
21269460 2011 Initial characterization of the human central proteome.
More...