Property Summary

NCBI Gene PubMed Count 40
PubMed Score 128.84
PubTator Score 1228.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Necrotizing Enterocolitis 17
Disease Target Count
Diabetic complication 3
Disease Target Count P-value
tuberculosis 1563 2.88039203933964E-8
acute quadriplegic myopathy 1157 2.9164965354745E-7
group 3 medulloblastoma 2254 8.2764139368847E-6
Breast cancer 3099 2.04814745844265E-4
ovarian cancer 8492 2.18421817501278E-4
glioblastoma 5572 4.37838351197277E-4
astrocytoma 1493 0.00211966797962226
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00395355330651755
Disease Target Count Z-score Confidence
Pancreatic cystadenoma 3 3.177 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 0.002
glioblastoma 1.500 0.000
acute quadriplegic myopathy 1.124 0.000
tuberculosis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.169 0.004
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.700 0.000
Breast cancer 1.100 0.000

Synonym

Accession P14550 A8KAL8 D3DQ04 Q6IAZ4
Symbols ALR
ARM
DD3
ALDR1
HEL-S-6

Gene

PANTHER Protein Class (2)

PDB

2ALR  

  Ortholog (11)

Gene RIF (13)

PMID Text
23747692 prostaglandin F synthase activity of human and bovine aldo-keto reductases
23643085 AKR1A1 could be involved in the metabolism of 4-hydroxynonenal and play a role in the resistance to oxidative stress
21276435 AKR1A1 has little effect on the production of gamma-hydroxybutyrate
20453000 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19423521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18495158 the binding site residues deviating between ALR1 and ALR2 influence ligand affinity in a complex interplay, presumably involving changes of dynamic properties and differences of the solvation/desolvation balance upon ligand binding
More...

AA Sequence

MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV      1 - 70
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY     71 - 140
KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY    141 - 210
SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT    211 - 280
FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY                             281 - 325
//

Text Mined References (49)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23747692 2013 Evaluation of the prostaglandin F synthase activity of human and bovine aldo-keto reductases: AKR1A1s complement AKR1B1s as potent PGF synthases.
23643085 2013 [Effect of AKR1A1 knock-down on H2;O2; and 4-hydroxynonenal-induced cytotoxicity in human 1321N1 astrocytoma cells].
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21276435 2011 The role of aldehyde reductase AKR1A1 in the metabolism of ?-hydroxybutyrate in 1321N1 human astrocytoma cells.
21269460 2011 Initial characterization of the human central proteome.
More...