Property Summary

Ligand Count 3
NCBI Gene PubMed Count 40
PubMed Score 131.73
PubTator Score 1228.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.124 2.9e-07
astrocytoma 1.100 2.1e-03
Breast cancer 1.100 2.0e-04
glioblastoma 1.500 4.4e-04
group 3 medulloblastoma 1.200 8.3e-06
ovarian cancer 1.700 2.2e-04
pancreatic ductal adenocarcinoma liver m... -1.169 4.0e-03
tuberculosis 1.400 2.9e-08

Synonym

Accession P14550 A8KAL8 D3DQ04 Q6IAZ4
Symbols ALR
ARM
DD3
ALDR1
HEL-S-6

Gene

PANTHER Protein Class (2)

PDB

2ALR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV      1 - 70
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY     71 - 140
KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY    141 - 210
SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT    211 - 280
FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY                             281 - 325
//

Text Mined References (49)

PMID Year Title