Property Summary

NCBI Gene PubMed Count 50
Grant Count 104
R01 Count 66
Funding $13,171,445.66
PubMed Score 611.81
PubTator Score 144.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (50)

Disease Z-score Confidence
Neuronal intestinal dysplasia 6 5.309 2.7
Poliomyelitis 11 4.092 2.0
Alport syndrome 21 3.595 1.8
Laurence-Moon syndrome 6 3.27 1.6
Hirschsprung's disease 42 3.252 1.6
Cancer 2,346 3.106 1.6
Kidney disease 396 3.064 1.5
Epidermolysis bullosa 21 3.049 1.5
Becker muscular dystrophy 187
Breast cancer 3,094
Carcinoma 2,147 1.0
Disease of cellular proliferation 3 2.0
Duchenne muscular dystrophy 602
Hydrocephalus Adverse Event 5
IGA Glomerulonephritis 454
Pick disease 1,893
Polycystic Ovary Syndrome 332
Weight Gain 87
acute quadriplegic myopathy 1,157
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
dermatomyositis 933
diabetes mellitus 1,663
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
nephrosclerosis 329
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087

Expression

Synonym

Accession P14543 Q14942 Q59FL2 Q5TAF2 Q5TAF3 Q86XD7 NID-1
Symbols NID

Gene

PDB

1NDX  

Gene RIF (9)

PMID Text
25924802 Increase of NID1 protein expression is associated with endometrial cancer invasion.
25857602 NID1 was confirmed as a target gene of MiR-192/215 in Hirschsprung's disease patients.
23681936 The cleavage of nidogen-1 and -2 is partially inhibited in human tumor samples.
23674478 results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders
22952693 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners
21478494 NID1 gene is a biologically plausible locus for nevogenesis and melanoma development
17328794 CpG islands of both NID1 and NID2 genes are aberrantly methylated in human cancer samples and cancer cell lines.
17008882 nidogen-2 is equivalent to nidogen-1 in skin-organotypic coculture, and both can promote the development of a functional basement membrane zone
12005023 found to be ubiquitous component of basement membrane zones underneath developing epithelia of most of the major organ systems; may participate in cell biological functions during human development

AA Sequence

MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELSGALRFYDRSD      1 - 70
IDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYYREDLSPSITQRAAECVHR     71 - 140
GFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQAVLASSDSSSYAIFLYPEDGLQFHTTFSKK    141 - 210
ENNQVPAVVAFSQGSVGFLWKSNGAYNIFANDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVI    211 - 280
LGTEDGAEYDDEDEDYDLATTRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERT    281 - 350
RSFQLAVETFHQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG    351 - 420
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLAPV    421 - 490
GGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGIDEHGHLTIDTELEGRVPQIP    491 - 560
FGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGASPSRIYTYQWRQTITFQECVHDDSRPALPST    561 - 630
QQLSVDSVFVLYNQEEKILRYALSNSIGPVREGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIG    631 - 700
FRGDGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCD    701 - 770
IPQRAQCIYTGGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV    771 - 840
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVDRDGREVEGTR    841 - 910
TRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLEGNTMRKTEAKAFLHVPAKVI    911 - 980
IGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDLGSPEGIAVDHLGRNIFWTDSNLDRIEVAKL    981 - 1050
DGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFS   1051 - 1120
SQLCWVDAGTNRAECLNPSQPSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPH   1121 - 1190
KQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK                1191 - 1247
//

Text Mined References (53)

PMID Year Title
25924802 2015 Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.
25857602 2015 Nidogen-1 is a common target of microRNAs MiR-192/215 in the pathogenesis of Hirschsprung's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23681936 2013 Contribution of ADAMTS1 as a tumor suppressor gene in human breast carcinoma. Linking its tumor inhibitory properties to its proteolytic activity on nidogen-1 and nidogen-2.
23674478 2013 Mutations in extracellular matrix genes NID1 and LAMC1 cause autosomal dominant Dandy-Walker malformation and occipital cephaloceles.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
More...