Property Summary

NCBI Gene PubMed Count 50
PubMed Score 611.81
PubTator Score 144.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
astrocytoma 1493 3.5102465300622E-21
oligodendroglioma 2849 1.04918369328881E-12
juvenile dermatomyositis 1189 1.37352328894412E-11
posterior fossa group A ependymoma 1511 2.38742306931609E-11
nasopharyngeal carcinoma 1056 2.40413555316585E-8
glioblastoma 5572 8.7426900041246E-8
pediatric high grade glioma 2712 1.2720475902522E-7
Duchenne muscular dystrophy 602 7.488258962762E-7
sonic hedgehog group medulloblastoma 1482 1.63153597240465E-6
Breast cancer 3099 2.37521689854516E-6
pilocytic astrocytoma 3086 5.99500438593797E-6
ulcerative colitis 2087 1.17102459883191E-5
primitive neuroectodermal tumor 3031 3.00360994874532E-5
interstitial cystitis 2299 3.56391160559061E-5
tuberculosis and treatment for 3 months 327 1.27331961946014E-4
atypical teratoid / rhabdoid tumor 4369 2.22091183279072E-4
medulloblastoma, large-cell 6234 3.08339126125687E-4
acute quadriplegic myopathy 1157 0.00101035331847064
pituitary cancer 1972 0.00260381205984693
invasive ductal carcinoma 2950 0.00270218142262216
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00383302686823103
mucosa-associated lymphoid tissue lymphoma 480 0.00810013036731467
nephrosclerosis 329 0.00906376541473911
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0105590457647948
adrenocortical adenoma 134 0.0108193930275673
Becker muscular dystrophy 187 0.0122425721884058
adrenocortical carcinoma 1427 0.0124197328133478
diabetes mellitus 1663 0.0185699717709701
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0190838344137841
Polycystic Ovary Syndrome 335 0.0208622381423734
dermatomyositis 967 0.0244476279213878
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0260731849129411
psoriasis 6685 0.0292031457763973
osteosarcoma 7933 0.0329965481808176
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0363041396898787
Pick disease 1893 0.0376369817530672
aldosterone-producing adenoma 664 0.0484154949702863
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Disease of cellular proliferation 3 0.0 2.0

Expression

Synonym

Accession P14543 Q14942 Q59FL2 Q5TAF2 Q5TAF3 Q86XD7 NID-1
Symbols NID

Gene

PDB

1NDX  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
25924802 Increase of NID1 protein expression is associated with endometrial cancer invasion.
25857602 NID1 was confirmed as a target gene of MiR-192/215 in Hirschsprung's disease patients.
23681936 The cleavage of nidogen-1 and -2 is partially inhibited in human tumor samples.
23674478 results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders
22952693 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners
21478494 NID1 gene is a biologically plausible locus for nevogenesis and melanoma development
17328794 CpG islands of both NID1 and NID2 genes are aberrantly methylated in human cancer samples and cancer cell lines.
17008882 nidogen-2 is equivalent to nidogen-1 in skin-organotypic coculture, and both can promote the development of a functional basement membrane zone
12005023 found to be ubiquitous component of basement membrane zones underneath developing epithelia of most of the major organ systems; may participate in cell biological functions during human development

AA Sequence

MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDFVSPALELSGALRFYDRSD      1 - 70
IDAVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYYREDLSPSITQRAAECVHR     71 - 140
GFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQAVLASSDSSSYAIFLYPEDGLQFHTTFSKK    141 - 210
ENNQVPAVVAFSQGSVGFLWKSNGAYNIFANDRESVENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVI    211 - 280
LGTEDGAEYDDEDEDYDLATTRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERT    281 - 350
RSFQLAVETFHQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG    351 - 420
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLAPV    421 - 490
GGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGIDEHGHLTIDTELEGRVPQIP    491 - 560
FGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGASPSRIYTYQWRQTITFQECVHDDSRPALPST    561 - 630
QQLSVDSVFVLYNQEEKILRYALSNSIGPVREGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIG    631 - 700
FRGDGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCD    701 - 770
IPQRAQCIYTGGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV    771 - 840
PGEVEKTRCQHEREHILGAAGATDPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVDRDGREVEGTR    841 - 910
TRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLEGNTMRKTEAKAFLHVPAKVI    911 - 980
IGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDLGSPEGIAVDHLGRNIFWTDSNLDRIEVAKL    981 - 1050
DGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFS   1051 - 1120
SQLCWVDAGTNRAECLNPSQPSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPH   1121 - 1190
KQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK                1191 - 1247
//

Text Mined References (53)

PMID Year Title
25924802 2015 Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.
25857602 2015 Nidogen-1 is a common target of microRNAs MiR-192/215 in the pathogenesis of Hirschsprung's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23681936 2013 Contribution of ADAMTS1 as a tumor suppressor gene in human breast carcinoma. Linking its tumor inhibitory properties to its proteolytic activity on nidogen-1 and nidogen-2.
23674478 2013 Mutations in extracellular matrix genes NID1 and LAMC1 cause autosomal dominant Dandy-Walker malformation and occipital cephaloceles.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
More...