Property Summary

Ligand Count 2,398
NCBI Gene PubMed Count 1,080
PubMed Score 1882.17
PubTator Score 2726.55

Knowledge Summary

Patent (29,539)

TINX Plot

  Disease (7)

Disease Target Count
Schizophrenia 1160
Parkinson's disease 392
Hyperprolactinemia 27
Bipolar Disorder 666
Major Depressive Disorder 301
Schizoaffective Disorder 55
Acromegaly 51
Acute intermittent porphyria 15
Agitation associated with Bipolar Mania 5
Agitation associated with Schizophrenia 5
Allergic conjunctivitis 22
Allergic rhinitis 95
Angioedema 38
Anxiety 136
Bipolar affective disorder, current episode depression 6
Bipolar affective disorder, current episode manic 13
Bipolar disorder in remission 19
Chemotherapy-induced nausea and vomiting 18
Chronic schizophrenia 16
Depression Treatment Adjunct 5
Dermatographic urticaria 5
Diabetic gastroparesis 7
Disruptive behavior disorder 3
Gastroesophageal reflux disease 110
Gastrointestinal Radiography Adjunct 11
General anesthesia 53
Gilles de la Tourette's syndrome 2
Infantile autism 4
Intra-Operative Nausea and Vomiting 2
Intractable Hiccups 3
Intubation of gastrointestinal tract 7
Itching of skin 18
Mixed anxiety and depressive disorder 12
Mixed bipolar I disorder 9
Nasal congestion 23
Nasal discharge 25
Nausea 20
Nausea and vomiting 97
Nonpsychotic Anxiety 2
Parkinsonism 18
Post-Operative Nausea and Vomiting 4
Postencephalitic parkinsonism 12
Postoperative nausea and vomiting 1
Pre-Op Apprehension 10
Prevention of Post-Operative Nausea and Vomiting 14
Prolonged-Severe Nausea and Vomiting 2
Psychotic disorder 6
Restless legs 4
Sneezing 12
Suicidal Behavior in Schizoaffective Disorder 2
Suicidal Behavior in Schizophrenia 2
Tetanus Adjunct Treatment 8
Treatment-resistant schizophrenia 6
Type 2 Diabetes Mellitus Treatment Adjunct 7
Urticaria 67
Vomiting 116
Disease Target Count P-value
lung carcinoma 2843 6.2e-15
osteosarcoma 7950 1.1e-06
psoriasis 6694 1.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alcohol dependence 107 6.458 3.2
Opiate dependence 29 0.0 5.0

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma 2.300 6.2e-15
osteosarcoma 2.063 1.1e-06
psoriasis 1.200 1.9e-04

Protein-protein Interaction (4)

Gene RIF (1218)

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTN      1 - 70
YLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPM     71 - 140
LYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYI    141 - 210
KIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELE    211 - 280
MEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGK    281 - 350
TRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA    351 - 420
VNPIIYTTFNIEFRKAFLKILHC                                                   421 - 443
//

Text Mined References (1085)

PMID Year Title