Property Summary

NCBI Gene PubMed Count 1,009
Grant Count 693
R01 Count 238
Funding $111,729,131.82
PubMed Score 1775.17
PubTator Score 2726.55

Knowledge Summary

Patent (29,539)

TINX Plot

  Disease Relevance (108)

Disease Z-score Confidence
Schizophrenia 501 6.755 3.4
Alcohol dependence 107 6.451 3.2
Parkinson's disease 364 5.483 2.7
Substance abuse 55 5.206 2.6
Nicotine dependence 53 5.082 2.5
Attention deficit hyperactivity disorder 156 5.041 2.5
Gilles de la Tourette syndrome 47 4.516 2.3
Pathological gambling 16 4.458 2.2
Cocaine dependence 24 4.418 2.2
Hyperprolactinemia 22 4.342 2.2
Heroin dependence 30 4.315 2.2
Bipolar Disorder 266 4.294 2.1
Antisocial personality disorder 9 4.243 2.1
Anxiety disorder 22 4.194 2.1
Pituitary adenoma 35 4.083 2.0
Brain disease 83 3.791 1.9
Obesity 616 3.652 1.8
Delusional disorder 10 3.632 1.8
Adenoma 165 3.631 1.8
Conduct disorder 25 3.504 1.8
Stuttering 18 3.381 1.7
Major Depressive Disorder 106 3.309 1.7
Alexithymia 14 3.225 1.6
Eating disorder 24 3.192 1.6
Schizoaffective disorder 33 3.185 1.6
Schizophreniform disorder 5 3.183 1.6
Huntington's disease 72 3.18 1.6
Acromegaly 40
Acute intermittent porphyria 14
Agitation associated with Bipolar Mania 5
Agitation associated with Schizophrenia 5
Allergic conjunctivitis 25
Allergic rhinitis 91
Amphetamine-Related Disorders 74
Angioedema 36
Anxiety 24
Anxiety Disorders 37
Basal Ganglia Diseases 12
Bipolar affective disorder, current epis... 6 
Bipolar affective disorder, current epis... 13 
Bipolar disorder in remission 19
Bradycardia 24
Catalepsy 15
Chemotherapy-induced nausea and vomiting 18
Chronic schizophrenia 4
Cocaine-Related Disorders 88
Cognition Disorders 23
Depression Treatment Adjunct 5
Dermatographic urticaria 6
Developmental Disabilities 20
Diabetic gastroparesis 7
Disruptive behavior disorder 3
Disruptive, Impulse Control, and Conduct... 3 
Dyskinesia, Drug-Induced 15
Dyskinetic syndrome 6
Gastroesophageal reflux disease 37
Gastrointestinal Radiography Adjunct 11
General anesthesia 53
Gilles de la Tourette's syndrome 3
Hyperactive behavior 31
Hypertensive disease 193
Hypotension 53
Infantile autism 4
Intra-Operative Nausea and Vomiting 2
Intractable Hiccups 3
Intubation of gastrointestinal tract 7
Itching of skin 19
Language Disorders 2
Memory Disorders 36
Mixed anxiety and depressive disorder 10
Mixed bipolar I disorder 9
Movement Disorders 21
Myoclonic dystonia 3
Nasal congestion 24
Nasal discharge 26
Nausea 9
Nausea and vomiting 6
Nonpsychotic Anxiety 2
Pain 70
Parkinson Disease 102
Parkinsonian Disorders 23
Parkinsonism 19
Pituitary Neoplasms 6
Post-Operative Nausea and Vomiting 4
Postencephalitic parkinsonism 12
Postoperative nausea and vomiting 1
Pre-Op Apprehension 10
Prevention of Post-Operative Nausea and ... 14 
Prolonged-Severe Nausea and Vomiting 2
Psychotic disorder 6
Restless legs 5
Seizures 95
Sneezing 11
Substance Withdrawal Syndrome 52
Substance-Related Disorders 114
Suicidal Behavior in Schizoaffective Dis... 2 
Suicidal Behavior in Schizophrenia 2
Tachycardia 17
Tetanus Adjunct Treatment 8
Tobacco Use Disorder 10
Treatment-Resistant Schizophrenia 3
Type 2 Diabetes Mellitus Treatment Adjun... 7 
Urticaria 53
Vomiting 9
Weight Gain 87
lung carcinoma 2,844
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.000
osteosarcoma 2.063 0.000
lung carcinoma 2.300 0.000

Synonym

Accession P14416 Q9NZR3 Q9UPA9
Symbols D2R
D2DR

Gene

PANTHER Protein Class (2)

PDB

1I15   5AER  

  TechDev Info (2)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model

MLP Assay (21)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
485344 screening 6869 / 0 / 292815 HTS Assay for Allosteric Antagonists of the Human D2 Dopamine Receptor: Primary Screen for Antagonists
485347 screening 1178 / 0 / 341506 HTS Assay for Positive Allosteric Modulators of the Human D2 Dopamine Receptor: Primary Screen for Potentiators
485358 screening 1780 / 0 / 336496 HTS Assay for Allosteric Agonists of the Human D2 Dopamine Receptor: Primary Screen for Agonists
485359 summary 0 / 0 / 0 HTS Assay for Allosteric Antagonists of the Human D2 Dopamine Receptor: Antagonists Summary
485361 summary 0 / 0 / 0 HTS Assay for Positive Allosteric Modulators of the Human D2 Dopamine Receptor: Agonists Summary
485362 summary 0 / 0 / 0 HTS Assay for Positive Allosteric Modulators of the Human D2 Dopamine Receptor: Potentiators Summary
624453 confirmatory 0 / 0 / 23 HTS Assay for Allosteric Antagonists of the Human D2 Dopamine Receptor: Hit Validation in primary assay
624461 other 1 / 0 / 0 HTS Assay for Allosteric Antagonists of the Human D2 Dopamine Receptor: Hit Validation in Radioligand Assay
More...

Gene RIF (1148)

PMID Text
27324537 The children with AA genotype of DRD2 gene and low family adaptability were tend to be associated with low regularity.
27222427 The minor allele of the D2 dopamine receptor gene is associated with food addiction.
27035534 Dopaminergic neurons derived from opioid-dependent patient induced pluripotent stem cells express lower levels of DRD2.
26986136 rs1800497 associated with post-traumatic stress disorder [meta-analysis]
26979958 A new algorithm, called ET-MIp, identifies evolutionarily relevant patterns of amino acid covariations in dopamine D2 receptor.
26970175 pattern of three Taq1 polymorphism of ANKK1 and DRD3 allele frequency, haplotypes and linkage disequilibrium was examined in five Punjabi ethnic groups
26808641 rs1800497 and rs4633 play important roles in the anorexia nervosa (AN) susceptibility with respect to the Chinese Han population. The gene-gene interaction between DRD2 and COMT contributes to the risk of AN.
26666695 evidence for rs2514218 association with antipsychotic response
26664790 Ankyrin repeat and kinase domain containing I (ANKK1) and dopamine D2 receptor (DRD2) genes associated with psychopathic traits. We hypothesized that cognitive phenomena are associated with Taq IA SNP of the ANKK1 gene and with C957T SNP of DRD2.
26632697 There was no significant relationship between Migraine susceptibility and genetic polymorphisms of DRD2 rs1799732 and rs6275.
More...

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTN      1 - 70
YLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPM     71 - 140
LYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYI    141 - 210
KIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELE    211 - 280
MEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGK    281 - 350
TRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA    351 - 420
VNPIIYTTFNIEFRKAFLKILHC                                                   421 - 443
//

Text Mined References (1014)

PMID Year Title
27324537 2016 [Effects of rs4274224 polymorphisms in the DRD2 gene and family factors on the regularity based on the temperament in school-age children].
27222427 2016 Food cravings, food addiction, and a dopamine-resistant (DRD2 A1) receptor polymorphism in Asian American college students.
27035534 2016 Lower Dopamine D2 Receptor Expression Levels in Human Dopaminergic Neurons Derived From Opioid-Dependent iPSCs.
26986136 2016 The Association Between Genetic Variants in the Dopaminergic System and Posttraumatic Stress Disorder: A Meta-Analysis.
26979958 2016 Intramolecular allosteric communication in dopamine D2 receptor revealed by evolutionary amino acid covariation.
26970175 2016 Analysis of ANKKI (rs1800497) and DRD2 (rs1079597, rs1800498) variants in five ethnic groups from Punjab, North-West India.
26808641 2016 Dopamine receptor D2 and catechol-O-methyltransferase gene polymorphisms associated with anorexia nervosa in Chinese Han population: DRD2 and COMT gene polymorphisms were associated with AN.
26666695 2016 Preliminary evidence for association of genome-wide significant DRD2 schizophrenia risk variant with clozapine response.
26664790 2015 The ANKK1/DRD2 locus is a genomic substrate for affective priming and recognition of angry faces.
26632697 2015 Association Between Polymorphisms of DRD2, COMT, DBH, and MAO-A Genes and Migraine Susceptibility: A Meta-Analysis.
More...