Property Summary

Ligand Count 3
NCBI Gene PubMed Count 40
PubMed Score 23.86
PubTator Score 16.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 2.300 4.8e-03
atypical teratoid / rhabdoid tumor -2.100 6.0e-04
glioblastoma -1.100 7.8e-04
group 3 medulloblastoma -1.900 1.5e-03
medulloblastoma, large-cell -2.800 6.1e-06
mucosa-associated lymphoid tissue lympho... 1.197 2.7e-02
osteosarcoma -1.970 3.0e-04
pituitary cancer 2.300 7.7e-05
primitive neuroectodermal tumor -1.400 2.3e-03
psoriasis -1.100 5.4e-39

Protein-protein Interaction (5)

Gene RIF (16)

AA Sequence

MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHT      1 - 70
PKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDN     71 - 140
GVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAEN    141 - 210
LGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGR    211 - 280
VAFKLRINKT                                                                281 - 290
//

Text Mined References (43)

PMID Year Title