Property Summary

NCBI Gene PubMed Count 40
PubMed Score 19.30
PubTator Score 16.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.970 0.000
glioblastoma -1.100 0.001
sonic hedgehog group medulloblastoma -3.500 0.000
astrocytoma 2.300 0.005
atypical teratoid/rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.400 0.002
mucosa-associated lymphoid tissue lympho... 1.197 0.027
pituitary cancer 2.300 0.000
psoriasis -1.100 0.000

Synonym

Accession P14415 A0AV17 A8K278 D3DTQ2 O60444
Symbols AMOG

Gene

Gene RIF (16)

PMID Text
21196491 Retinoschisin, the protein involved in the pathogenesis of X-linked juvenile retinoschisis, membrane association is severely impaired in the absence of ATP1A3 and ATP1B2.
20937802 analysis of pathways for maturation of the Na,K-ATPase beta1 and beta2 subunits in the endoplasmic reticulum
20656459 The AMOG expression pattern with altered cellular distribution observed in malformations of cortical development suggests that AMOG might contribute to abnormal cortical development via mTOR activation.
19764716 the ER quality control system allows export only of assembled alpha-beta complexes to the Golgi, whereas the number of alpha(1) subunits in the ER determines the amount of the alpha-beta complexes
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19371356 The strong expression of AMOG within the precursor cells of gangliogliomas may represent an additional marker for the diagnostic evaluation of these glioneuronal lesions
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17683073 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHT      1 - 70
PKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDN     71 - 140
GVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAEN    141 - 210
LGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGR    211 - 280
VAFKLRINKT                                                                281 - 290
//

Text Mined References (43)

PMID Year Title
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
24815991 2014 Clonal heterogeneity of lymphoid malignancies correlates with poor prognosis.
23887941 2013 Na?/K?-ATPase ?2-subunit (AMOG) expression abrogates invasion of glioblastoma-derived brain tumor-initiating cells.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
21196491 2011 The Na/K-ATPase is obligatory for membrane anchorage of retinoschisin, the protein involved in the pathogenesis of X-linked juvenile retinoschisis.
20937802 2010 Diverse pathways for maturation of the Na,K-ATPase ?1 and ?2 subunits in the endoplasmic reticulum of Madin-Darby canine kidney cells.
20656459 2010 Expression patterns of AMOG in developing human cortex and malformations of cortical development.
20065300 2010 Expression and distribution of Na, K-ATPase isoforms in the human uterus.
19764716 2009 Assembly with the Na,K-ATPase alpha(1) subunit is required for export of beta(1) and beta(2) subunits from the endoplasmic reticulum.
19694409 2009 A C-terminal lobe of the beta subunit of Na,K-ATPase and H,K-ATPase resembles cell adhesion molecules.
More...