Property Summary

NCBI Gene PubMed Count 40
Grant Count 9
R01 Count 9
Funding $2,117,108.83
PubMed Score 127.70
PubTator Score 61.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Endometriosis 1.452 0.015
osteosarcoma -2.422 0.000
cystic fibrosis 1.570 0.000
glioblastoma 2.000 0.016
medulloblastoma, large-cell -1.600 0.000
Atopic dermatitis -1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.206 0.001
non-small cell lung cancer -2.534 0.000
intraductal papillary-mucinous adenoma (... -2.200 0.005
lung cancer -4.800 0.000
colon cancer -1.900 0.002
active Crohn's disease -1.125 0.031
active ulcerative colitis -1.396 0.014
breast carcinoma -1.200 0.045
interstitial cystitis 1.200 0.012
adult high grade glioma 1.600 0.008
group 3 medulloblastoma -1.400 0.027
lung adenocarcinoma -1.200 0.003
invasive ductal carcinoma -2.400 0.010
lung carcinoma -3.200 0.000
Pick disease 1.700 0.000
ductal carcinoma in situ -2.100 0.012
ovarian cancer 1.100 0.000
head and neck cancer and chronic obstruc... 1.100 0.015

Gene RIF (12)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of carboxypeptidase M (CPM) in primary human brain microvascular endothelial cells
24108126 CPM binding to extracellular loop 2 of the B1R results in positive allosteric modulation of B1R signaling, and disruption of this interaction could provide a novel therapeutic approach to reduce pathological B1R signaling.
23172796 Carboxypeptidase M expression is lost in human renal cell carcinoma tumor cells, whereas it is abundant in tumor-associated foam cells and neovasculature.
22157720 novel marker and cellular player in lipid uptake and/or metabolism of activated macrophages by promoting foam cell formation
21454694 CPM and B1Rs on cell membranes form a critical complex that potentiates B1R signaling.
20673876 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19820690 CPM amplification could be used as an alternative diagnostic tool for the diagnosis of well-differentiated liposarcoma/atypical lipomatous tumors.
18292211 Cleavage of the C-terminal lysine residue of SDF-1alpha by CPM leads to attenuated chemotactic responses.
18187413 Carboxypeptidase M and kinin B1 receptors interact to facilitate efficient b1 signaling from B2 agonists
15066430 Results report the crystallization of human carboxypeptidase M and its 3.0 angstrom crystal structure.
More...

AA Sequence

MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHR      1 - 70
IGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYY     71 - 140
SIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGAL    141 - 210
YSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITL    211 - 280
ELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGE    281 - 350
YYLLLLPGSYIINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP    351 - 420
DHSAATKPSLFLFLVSLLHIFFK                                                   421 - 443
//

Text Mined References (42)

PMID Year Title
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24108126 2013 Carboxypeptidase M is a positive allosteric modulator of the kinin B1 receptor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23172796 2013 Mapping of carboxypeptidase m in normal human kidney and renal cell carcinoma: expression in tumor-associated neovasculature and macrophages.
22157720 2012 Carboxypeptidase-M is regulated by lipids and CSFs in macrophages and dendritic cells and expressed selectively in tissue granulomas and foam cells.
21454694 2011 Cross-talk between carboxypeptidase M and the kinin B1 receptor mediates a new mode of G protein-coupled receptor signaling.
20673876 2010 Genome-wide association-, replication-, and neuroimaging study implicates HOMER1 in the etiology of major depression.
19820690 2009 Carboxypeptidase M: a biomarker for the discrimination of well-differentiated liposarcoma from lipoma.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
More...