Property Summary

NCBI Gene PubMed Count 43
Grant Count 21
R01 Count 17
Funding $1,085,475.24
PubMed Score 32.77
PubTator Score 348.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.400 0.000
group 3 medulloblastoma 1.200 0.010
lung cancer 1.400 0.001
lung adenocarcinoma 1.156 0.000
ovarian cancer 1.300 0.000

Gene RIF (18)

PMID Text
26568293 Studied the expression of TRIM27 in normal ovarian and fallopian tube epithelial cells and in ovarian serous carcinoma cells; correlated TRIM27 expression with clinical and pathological parameters.
25320289 Authors observed rapid, ICP0-dependent loss of TRIM27 during HSV-1 infection.
25223908 Study found that compared to healthy individuals, Trim27 was significantly upregulated in patients with Parkinson's disease
24794433 The neoplasm leading cell specific expression of integrin beta1 was posttranscriptionally regulated by the TRIM27/MRTF-B complex in response to the loss of intercellular adhesion.
23452853 These findings provide a cellular and molecular function for MAGE-L2-TRIM27 in retrograde transport, including an unappreciated role of K63-linked ubiquitination and identification of an activating signal of the WASH regulatory complex.
23419514 RFP-mediated ubiquitination of PTEN modulates its effect on AKT activation.
23342271 RFP-knockdown ovarian cancer cells exhibited lower carboplatin resistance than control cells. These findings suggest that RFP could be a predictive marker for chemoresistance in ovarian cancer patients.
22829933 Data conclude that TRIM27 negatively regulates NOD2-mediated signaling by degradation of NOD2 and suggest that TRIM27 could be a new target for therapeutic intervention in NOD2-associated diseases.
22556269 TRIM27 expression is a modifier of cancer incidence and progression and is a potential target for intervention.
22128329 These findings provide a unique mechanism for regulating class II PI3Ks, and identify TRIM27 as a previously undescribed negative regulator of CD4 T cells.
More...

AA Sequence

MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRH      1 - 70
LANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFK     71 - 140
EQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLA    141 - 210
IYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIF    211 - 280
AQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDN    281 - 350
PERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL    351 - 420
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIIC    421 - 490
PMSGIDGFSGHVGNHGHSMETSP                                                   491 - 513
//

Text Mined References (45)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26568293 2016 Downregulation of TRIM27 expression inhibits the proliferation of ovarian cancer cells in vitro and in vivo.
25416956 2014 A proteome-scale map of the human interactome network.
25320289 2015 Identification of TRIM27 as a novel degradation target of herpes simplex virus 1 ICP0.
25223908 2014 Deficiency of Trim27 protects dopaminergic neurons from apoptosis in the neurotoxin model of Parkinson's disease.
24794433 2014 TRIM27/MRTF-B-dependent integrin ?1 expression defines leading cells in cancer cell collectives.
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23452853 2013 Regulation of WASH-dependent actin polymerization and protein trafficking by ubiquitination.
23419514 2013 RFP-mediated ubiquitination of PTEN modulates its effect on AKT activation.
23342271 2012 Expression of RET finger protein predicts chemoresistance in epithelial ovarian cancer.
More...