Property Summary

NCBI Gene PubMed Count 47
PubMed Score 33.01
PubTator Score 348.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Papillary thyroid carcinoma 43
Disease Target Count P-value
lung adenocarcinoma 2716 9.6e-06
ovarian cancer 8520 6.6e-05
psoriasis 6694 3.5e-04
lung cancer 4740 1.5e-03
group 3 medulloblastoma 4104 1.0e-02
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Opitz-GBBB syndrome 18 3.334 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.0e-02
lung adenocarcinoma 1.156 9.6e-06
lung cancer 1.400 1.5e-03
ovarian cancer 1.300 6.6e-05
psoriasis 1.400 3.5e-04

Protein-protein Interaction (2)

Gene RIF (19)

AA Sequence

MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRH      1 - 70
LANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFK     71 - 140
EQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLA    141 - 210
IYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIF    211 - 280
AQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDN    281 - 350
PERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL    351 - 420
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIIC    421 - 490
PMSGIDGFSGHVGNHGHSMETSP                                                   491 - 513
//

Text Mined References (49)

PMID Year Title