Property Summary

Ligand Count 149
NCBI Gene PubMed Count 54
PubMed Score 876.82
PubTator Score 281.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P14324 D3DV91 E9PCI9 Q96G29 FPP synthase
Symbols FPS
FPPS
POROK9

Gene

PANTHER Protein Class (2)

PDB

1YQ7   1YV5   1ZW5   2F7M   2F89   2F8C   2F8Z   2F92   2F94   2F9K   2OPM   2OPN   2QIS   2RAH   2VF6   3B7L   3CP6   3N1V   3N1W   3N3L   3N45   3N46   3N49   3N5H   3N5J   3N6K   3RYE   3S4J   4DEM   4GA3   4H5C   4H5D   4H5E   4JVJ   4KFA   4KPD   4KPJ   4KQ5   4KQS   4KQU   4L2X   4LFV   4LPG   4LPH   4N1Z   4N9U   4NFI   4NFJ   4NFK   4NG6   4NKE   4NKF   4NUA   4OGU   4P0V   4P0W   4P0X   4PVX   4PVY   4Q23   4QPF   4QXS   4RXA   4XQR   4XQS   4XQT   5CG5   5CG6   5DGM   5DGN   5DGS   5DIQ   5DJP   5DJR   5DJV   5JA0   5JUZ   5JV0   5JV1   5JV2   5KSX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (12)

Gene RIF (29)

AA Sequence

MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGD      1 - 70
QNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEP     71 - 140
RKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLK    141 - 210
LYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAM    211 - 280
YMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQ    281 - 350
ILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK     351 - 419
//

Text Mined References (68)

PMID Year Title