Property Summary

NCBI Gene PubMed Count 53
Grant Count 138
R01 Count 91
Funding $29,371,733.2
PubMed Score 818.98
PubTator Score 281.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14324 D3DV91 E9PCI9 Q96G29 FPP synthase
Symbols FPS
FPPS
POROK9

Gene

PANTHER Protein Class (2)

PDB

1YQ7   1YV5   1ZW5   2F7M   2F89   2F8C   2F8Z   2F92   2F94   2F9K   2OPM   2OPN   2QIS   2RAH   2VF6   3B7L   3CP6   3N1V   3N1W   3N3L   3N45   3N46   3N49   3N5H   3N5J   3N6K   3RYE   3S4J   4DEM   4GA3   4H5C   4H5D   4H5E   4JVJ   4KFA   4KPD   4KPJ   4KQ5   4KQS   4KQU   4L2X   4LFV   4LPG   4LPH   4N1Z   4N9U   4NFI   4NFJ   4NFK   4NG6   4NKE   4NKF   4NUA   4OGU   4P0V   4P0W   4P0X   4PVX   4PVY   4Q23   4QPF   4QXS   4RXA   4XQR   4XQS   4XQT   5CG5   5CG6   5DGM   5DGN   5DGS   5DIQ   5DJP   5DJR   5DJV  

Gene RIF (28)

PMID Text
25630225 These results are consistent with the previously proposed hypothesis that the allosteric pocket of human FPPS, located near the active site, plays a feed-back regulatory role for this enzyme.
24927548 The results identify new classes of FPPS inhibitors, diterpenoids and sesquiterpenoids, that bind to the IPP site and may be of interest as anticancer and antiinfective drug leads.
24598914 A co-crystal structure of human farnesyl pyrophosphate synthase in complex with a bisphosphonate and two molecules of inorganic phosphate.
24534219 our study indicated that DR patients have higher VEGF levels than diabetic patients without retinopathy, and -2578A/C (rs699947) and +405C/G (rs2010963) may be important factors in determining serum VEGF levels.
24369118 These observations suggest that an increase in the expression of endogenous FPPS could confer at least partial resistance to the pharmacological effect of N-BP drugs such as ZOL in vivo
24311107 Results suggest that polymorphisms of the FDPS gene may influence the bone response to drugs targeting the mevalonate pathway, like statins.
23998921 Data indicate compounds represent a new structural class of farnesyl pyrophosphate synthase (hFPPS) inhibitors and suggest a development of therapeutics.
23847096 The iPA-driven modulation of FDPS can cause an enhancement of post-translational prenylation essential for the biological activity of key proteins in NK signaling and effector functions, such as Ras.
23277274 FPPS might play an important role in Ang II-induced cardiac hypertrophy and fibrosis in vivo, at least in part through RhoA, p-38 MAPK and TGF-beta1.
23238007 LRP5 and FDPS loci age-specifically affect skeletal traits in healthy fertile women.
More...

AA Sequence

MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGD      1 - 70
QNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEP     71 - 140
RKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLK    141 - 210
LYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAM    211 - 280
YMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQ    281 - 350
ILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK     351 - 419
//

Text Mined References (67)

PMID Year Title
26202976 2015 Genomic variations of the mevalonate pathway in porokeratosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25630225 2015 Probing the molecular and structural elements of ligands binding to the active site versus an allosteric pocket of the human farnesyl pyrophosphate synthase.
24927548 2014 Taxodione and arenarone inhibit farnesyl diphosphate synthase by binding to the isopentenyl diphosphate site.
24598914 2014 Structure of human farnesyl pyrophosphate synthase in complex with an aminopyridine bisphosphonate and two molecules of inorganic phosphate.
24534219 2014 Association of farnesyl diphosphate synthase polymorphisms and response to alendronate treatment in Chinese postmenopausal women with osteoporosis.
24369118 2014 Upregulation of endogenous farnesyl diphosphate synthase overcomes the inhibitory effect of bisphosphonate on protein prenylation in Hela cells.
24311107 2014 Polymorphisms of the farnesyl diphosphate synthase gene modulate bone changes in response to atorvastatin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23998921 2013 Thienopyrimidine bisphosphonate (ThPBP) inhibitors of the human farnesyl pyrophosphate synthase: optimization and characterization of the mode of inhibition.
More...