Property Summary

NCBI Gene PubMed Count 44
Grant Count 2
Funding $19,947.6
PubMed Score 18.39
PubTator Score 35.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14317 B4DQ69 Q53Y93 Q6IBK9 Q9UDK0
Symbols HS1
p75
CTTNL
lckBP1

Gene

 Grant Application (2)

Gene RIF (15)

PMID Text
25359136 SDF1alpha-induced interaction of the adapter proteins Nck and HS1 facilitates actin polymerization and migration in T cells.
23017497 Phosphoproteome analyses reveal specific implications of Hcls1, p21-activated kinase 1 and Ezrin in proliferation of a myeloid progenitor cell line downstream of wild-type and ITD mutant Fms-like tyrosine kinase 3 receptors.
23001182 interaction of HCLS1 with LEF-1 is essential for G-CSF-triggered myeloid differentiation; data demonstrate the importance of HCLS1 in myelopoiesis in vitro and in vivo
22768161 HS1 overexpressed in leukemic as compared to normal B lymphocytes.
22679023 a novel role for HS1 and its phosphorylation during neutrophil directed migration.
22333038 High HS1 expression predicts poor survival of chronic lymphocytic leukemia patients.
21287358 SH3 domain of HS1 protein recognizes lysine-rich polyproline motifs.
20530793 HS1 is a central regulator of cytoskeleton remodeling that controls lymphocyte trafficking and homing and significantly influences the tissue invasion and infiltration in chronic lymphocytic leukemia.
17508001 HS1 may play a role in cytoskeleon organization in B-cells and leukemic B-cells
16157603 The HS1 coiled-coil region acts synergistically with the repeat domain in the modulation of the Arp2/3 complex-mediated actin polymerization.
More...

AA Sequence

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRK      1 - 70
KEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDY     71 - 140
KGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAV    141 - 210
GFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQ    211 - 280
PVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLE    281 - 350
GLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPA    351 - 420
GAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE        421 - 486
//

Text Mined References (51)

PMID Year Title
26903547 2016 Exome sequencing reveals recurrent germ line variants in patients with familial Waldenström macroglobulinemia.
25416956 2014 A proteome-scale map of the human interactome network.
25359136 2015 SDF1?-induced interaction of the adapter proteins Nck and HS1 facilitates actin polymerization and migration in T cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23017497 2013 Phosphoproteome analyses reveal specific implications of Hcls1, p21-activated kinase 1 and Ezrin in proliferation of a myeloid progenitor cell line downstream of wild-type and ITD mutant Fms-like tyrosine kinase 3 receptors.
23001182 2012 Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.
22768161 2012 HS1, a Lyn kinase substrate, is abnormally expressed in B-chronic lymphocytic leukemia and correlates with response to fludarabine-based regimen.
22679023 2012 The actin regulatory protein HS1 interacts with Arp2/3 and mediates efficient neutrophil chemotaxis.
22333038 2012 High expression of hematopoietic cell specific Lyn substrate-1 (HS1) predicts poor survival of B-cell chronic lymphocytic leukemia patients.
More...