Property Summary

NCBI Gene PubMed Count 57
Grant Count 70
R01 Count 39
Funding $4,362,112.9
PubMed Score 124.93
PubTator Score 96.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
cutaneous lupus erythematosus 1.300 0.018
psoriasis -1.600 0.000
osteosarcoma -1.326 0.003
astrocytoma 1.300 0.009
juvenile dermatomyositis 1.007 0.000
tuberculosis and treatment for 6 months -1.200 0.008
lung cancer -1.500 0.005
ovarian cancer -1.700 0.000

Synonym

Accession P14316 D6RCK5 H0Y8S3 Q6IAS7 Q96B99 IRF-2
Symbols IRF-2

Gene

Gene RIF (27)

PMID Text
26173586 It might play as a tumor suppressor by regulating P53 signaling in gastric cancer.
25285625 the association of IRF2 with susceptibility to systemic lupus erythematosus
25207663 IRF2genes were not associated with pancreatitis. 4 variants were found: c.123G>A (novel), c.651C>T, c.744G>A, and c.638C>T, p.P213L.
24632547 Data suggest that interferon regulatory factors 1 and 2 (IRF1 and IRF2) may serve as potential targets of therapy.
24607843 miR-221 directly inhibits the expression of SOCS3 and IRF2.
23554911 KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system.
22744333 IRF2 overexpression protects against I/R injury by decreasing IRF1-dependent injury and may represent a novel therapeutic strategy.
22119988 these results suggest that IRF-2 plays an important role in the tumorigenesis of pancreatic cancer and down-regulation of IRF-2 would be a new treatment target for pancreatic cancer.
22113474 The results suggested that distinct markers in IRF2 may be associated with atopic dermatitis and eczema herpeticum (which may depend upon ethnic ancestry) and genetic variants in IRF2 may contribute to an abnormal immune response to herpes simplex virus.
22042864 IFN regulatory factor 2 (Irf2) has a regulatory role in trypsinogen5 gene transcription, which is resistant to a major endogenous trypsin inhibitor, Spink3
More...

AA Sequence

MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVD      1 - 70
KPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP     71 - 140
VESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESD    141 - 210
EQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASF    211 - 280
VTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC     281 - 349
//

Text Mined References (63)

PMID Year Title
26173586 2016 MicroRNA-18a modulates P53 expression by targeting IRF2 in gastric cancer patients.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25285625 2014 Association of functional polymorphisms in interferon regulatory factor 2 (IRF2) with susceptibility to systemic lupus erythematosus: a case-control association study.
25207663 2014 Variants in the interferon regulatory factor-2 gene are not associated with pancreatitis in Japan.
24632547 2014 The roles of interferon regulatory factors 1 and 2 in the progression of human pancreatic cancer.
24607843 2014 Survival in patients with high-risk prostate cancer is predicted by miR-221, which regulates proliferation, apoptosis, and invasion of prostate cancer cells by inhibiting IRF2 and SOCS3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23554911 2013 Up-regulation of intestinal epithelial cell derived IL-7 expression by keratinocyte growth factor through STAT1/IRF-1, IRF-2 pathway.
22744333 2012 Interferon regulatory factor-2 is protective against hepatic ischemia-reperfusion injury.
More...