Property Summary

NCBI Gene PubMed Count 61
PubMed Score 132.66
PubTator Score 96.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Disease Target Count
Liver carcinoma 240
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Microphthalmia with limb anomalies 40 3.401 1.7
Cancer 2499 3.399 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.300 9.2e-03
cutaneous lupus erythematosus 1.300 1.8e-02
hepatocellular carcinoma 1.100 1.4e-03
juvenile dermatomyositis 1.007 1.1e-07
lung cancer -1.500 4.6e-03
osteosarcoma -1.326 3.1e-03
ovarian cancer -1.700 2.5e-07
psoriasis -1.600 4.9e-05
tuberculosis and treatment for 6 months -1.200 7.7e-03

Protein-protein Interaction (8)

Gene RIF (31)

AA Sequence

MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVD      1 - 70
KPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP     71 - 140
VESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESD    141 - 210
EQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASF    211 - 280
VTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC     281 - 349
//

Text Mined References (68)

PMID Year Title