Property Summary

NCBI Gene PubMed Count 45
PubMed Score 151.03
PubTator Score 43.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.200 5.5e-08
diabetes mellitus -1.100 5.4e-03
ependymoma 1.500 1.0e-02
glioblastoma 2.000 9.4e-08
lung adenocarcinoma 1.296 2.2e-06
medulloblastoma 1.700 2.6e-05
medulloblastoma, large-cell 2.400 8.8e-07
oligodendroglioma 1.500 6.1e-03
osteosarcoma -1.105 1.4e-02
pediatric high grade glioma 1.100 1.5e-03
primitive neuroectodermal tumor 1.300 3.1e-05
psoriasis -2.300 1.1e-05
Rheumatoid arthritis -1.900 9.9e-03

Protein-protein Interaction (12)

Gene RIF (22)

AA Sequence

MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDEPGTAAC      1 - 70
PNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKGRKERESLQQMAEVTREGFRL     71 - 140
KKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVKEEAEKPEREAKEQHQKLWEEQLAAAKAQQE    141 - 210
QELAADAFKELDDDMDGTVSVTELQTHPELDTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKY    211 - 280
RSEALPTDLPAPSAPDLTEPKEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEEAPPPLSPPQPASP    281 - 350
AEEDKMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTT    351 - 420
NEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETM    421 - 490
VTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL                                    491 - 528
//

Text Mined References (51)

PMID Year Title