Property Summary

Ligand Count 26
NCBI Gene PubMed Count 188
PubMed Score 1546.28
PubTator Score 382.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hemophagocytic lymphohistiocytosis 30 3.382 1.7
Disease Target Count
Aplastic Anemia 21

Expression

  Differential Expression (9)

Disease log2 FC p
colon cancer -1.400 4.3e-02
cutaneous lupus erythematosus 3.000 6.4e-05
interstitial cystitis 1.200 1.9e-03
lung adenocarcinoma -1.100 5.7e-07
lung cancer -2.200 6.1e-04
lung carcinoma -1.700 6.6e-16
non-small cell lung cancer -1.372 3.3e-11
osteosarcoma -2.592 8.2e-04
psoriasis -1.100 2.2e-03

 IMPC Phenotype (1)

 CSPA Cell Line (3)

Gene RIF (169)

AA Sequence

MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPVDTQRFLRPD      1 - 70
GTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPKPT     71 - 140
SNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQP    141 - 210
AYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACE    211 - 280
EKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLL    281 - 350
DSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT    351 - 420
FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRD    421 - 490
DDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW         491 - 555
//

Text Mined References (193)

PMID Year Title