Property Summary

Ligand Count 4
NCBI Gene PubMed Count 677
PubMed Score 2392.09
PubTator Score 2448.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Keratoconus 113 0.0 5.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma -1.873 4.4e-04
adrenocortical carcinoma -3.057 4.9e-07
Astrocytoma, Pilocytic 2.300 6.0e-07
Breast cancer -2.200 2.6e-02
ependymoma -1.100 4.6e-02
gastric carcinoma 1.600 3.8e-02
group 4 medulloblastoma -1.400 6.2e-03
interstitial cystitis 2.700 2.2e-05
intraductal papillary-mucinous adenoma (... -2.400 2.0e-03
intraductal papillary-mucinous carcinoma... -2.500 5.2e-03
intraductal papillary-mucinous neoplasm ... -3.000 6.8e-03
invasive ductal carcinoma -1.474 3.0e-02
lung cancer -2.200 4.9e-04
medulloblastoma, large-cell -2.000 4.8e-04
mucosa-associated lymphoid tissue lympho... -1.195 1.2e-02
Multiple myeloma 2.397 3.7e-02
non primary Sjogren syndrome sicca -1.100 1.9e-02
non-small cell lung cancer -1.772 2.1e-17
oligodendroglioma -1.200 7.3e-03
osteosarcoma -1.770 7.7e-03
ovarian cancer -1.200 4.1e-06
pediatric high grade glioma 1.200 3.3e-02
Rheumatoid arthritis 1.600 1.1e-02
subependymal giant cell astrocytoma 4.993 5.9e-03
tuberculosis 1.100 1.3e-03
ulcerative colitis 2.200 2.7e-05

Protein-protein Interaction (2)

PDB (28)

Gene RIF (615)

AA Sequence

MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC      1 - 70
ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTV     71 - 140
SITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE    141 - 210
CMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRW    211 - 280
EYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLR    281 - 350
ENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME    351 - 420
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKT    421 - 490
KQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEK    491 - 560
CKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLR    561 - 630
VAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIP    631 - 700
NRPGIFVRVAYYAKWIHKIILTYKVPQS                                              701 - 728
//

Text Mined References (677)

PMID Year Title