Property Summary

NCBI Gene PubMed Count 637
Grant Count 1,205
R01 Count 689
Funding $124,495,306.66
PubMed Score 2317.25
PubTator Score 2448.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (59)

Disease Z-score Confidence
Cancer 2,346 5.841 2.9
Liver disease 219 4.514 2.3
Kidney disease 396 3.971 2.0
Myocardial Infarction 126 3.719 1.9
Pulmonary Fibrosis 66 3.303 1.7
Limb ischemia 12 3.212 1.6
Ureteral disease 23 3.12 1.6
Barrett Esophagus 16
Breast cancer 3,094
Carcinoma 2,147 1.0
Cardiomyopathies 90
Copper-Overload Cirrhosis 11
DEAFNESS, AUTOSOMAL RECESSIVE 39 (disord... 1 
Diabetic Neuropathies 13
Hepatitis, Chronic 22
Leukemia, Myelocytic, Acute 113
Liver Cirrhosis 101
Liver Cirrhosis, Experimental 108
Liver Failure, Acute 22
Liver Neoplasms, Experimental 48
Liver carcinoma 217
Liver neoplasms 109
Multiple myeloma 1,327
Myocardial Ischemia 169
Neoplasm Invasiveness 127
Neoplasms, Experimental 33
Neuroblastoma 78
Nonsyndromic deafness 121 4.0
Pain 70
Pancreatitis 97
Parkinson Disease 102
Reperfusion Injury 84
Rheumatoid Arthritis 1,160
Squamous cell carcinoma 94
Thrombosis 42
Vascular Diseases 16
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
ependymoma 2,514
gastric carcinoma 832
group 4 medulloblastoma 1,875
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P14210 A1L3U6 Q02935 Q13494 Q14519 Q3KRB2 Q8TCE2 Q9BYL9 Q9BYM0 Q9UDU6
Symbols SF
HGFB
HPTA
F-TCF
DFNB39

Gene

HGF

PDB

1BHT   1GMN   1GMO   1GP9   1NK1   1SHY   1SI5   2HGF   2QJ2   3HMS   3HMT   3HN4   3MKP   3SP8   4D3C   4K3J   4O3T   4O3U   5COE   5CP9   5CS1   5CS3   5CS5   5CS9   5CSQ   5CT1   5CT2   5CT3  

Gene RIF (578)

PMID Text
27094128 Report the application of advanced quantitative fluorescence microscopy techniques to study changes in the oligomerization state of the RTK Met in response to stimulation by its endogenous ligand hepatocyte growth factor.
26934743 Pre-osteoblasts stimulate migration of breast cancer cells via the HGF/MET pathway.
26892517 level of HGF is associated with incident diabetes and may reflect a unique type of impaired metabolism
26857230 Treatment of bronchiolitis Obliterans with HGF gene modified MSCs results in reduction of local inflammation and promotion in recovery of allograft trachea histopathology.
26798059 these data demonstrate that FGF-2 priming enhances the angiogenic potential of SHED through the secretion of both HGF and VEGF.
26790028 we suggest that combinatorial therapeutic strategies with HGF and c-Met inhibitors comprise promising candidates for overcoming sorafenib resistance.
26722560 Low hemodialysis-induced release of the anti-inflammatory cytokine HGF correlates with impaired quality of life in that group of patients
26716644 High Serum level of hepatocyte growth factor is associated with resistance to the treatment with trastuzumab in HER2-positive patients with metastatic gastric cancer
26577828 High serum HGF levels in breast cancer patients are associated with clinically detectable regional node metastasis and, paradoxically, with longer relapse-free survival in stage II/III breast cancer.
26527860 Adenoviral delivery of truncated MMP-8 fused with the hepatocyte growth factor mutant 1K1 ameliorates liver cirrhosis and promotes hepatocyte proliferation.
More...

AA Sequence

MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC      1 - 70
ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTV     71 - 140
SITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE    141 - 210
CMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRW    211 - 280
EYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLR    281 - 350
ENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME    351 - 420
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKT    421 - 490
KQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEK    491 - 560
CKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLR    561 - 630
VAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIP    631 - 700
NRPGIFVRVAYYAKWIHKIILTYKVPQS                                              701 - 728
//

Text Mined References (638)

PMID Year Title
27094128 2016 Live cell imaging shows hepatocyte growth factor-induced Met dimerization.
26934743 2016 Pre-Osteoblasts Stimulate Migration of Breast Cancer Cells via the HGF/MET Pathway.
26892517 2016 Circulating level of hepatocyte growth factor predicts incidence of type 2 diabetes mellitus: The Multi-Ethnic Study of Atherosclerosis (MESA).
26857230 2016 Hepatocyte growth factor enhances the inflammation-alleviating effect of umbilical cord-derived mesenchymal stromal cells in a bronchiolitis obliterans model.
26798059 2016 Priming Dental Pulp Stem Cells With Fibroblast Growth Factor-2 Increases Angiogenesis of Implanted Tissue-Engineered Constructs Through Hepatocyte Growth Factor and Vascular Endothelial Growth Factor Secretion.
26790028 2016 Elevated hepatocyte growth factor expression as an autocrine c-Met activation mechanism in acquired resistance to sorafenib in hepatocellular carcinoma cells.
26722560 2015 Levels of hepatocyte growth factor in serum correlate with quality of life in hemodialysis patients.
26716644 2016 Serum level of hepatocyte growth factor is a novel marker of predicting the outcome and resistance to the treatment with trastuzumab in HER2-positive patients with metastatic gastric cancer.
26577828 2016 Prognostic implication of serum hepatocyte growth factor in stage II/III breast cancer patients who received neoadjuvant chemotherapy.
26527860 2015 Adenoviral delivery of truncated MMP-8 fused with the hepatocyte growth factor mutant 1K1 ameliorates liver cirrhosis and promotes hepatocyte proliferation.
More...