Property Summary

NCBI Gene PubMed Count 96
Grant Count 52
R01 Count 23
Funding $8,149,725.05
PubMed Score 449.42
PubTator Score 709.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GO Process (1)

Gene RIF (63)

PMID Text
26522646 Data show that CD99 antigen expression increased during in vitro differentiation of germinal center B cells and was highest in plasma cells (PCs).
26172215 CD99 can suppress CD98-mediated assembly of pro-tumorigenic signaling complexes through its ability to dephosphorylate focal adhesion kinase.
26000982 These results suggest that SEPTIN2-mediated cytoskeletal rearrangement and STATHMIN-mediated differentiation may contribute to changes in cell morphology and differentiation of H/RS cells with CD99 upregulation in Hodgkin lymphoma.
26000312 The results highlight an important role of CD99 in the differentiation and activity of human osteoblasts in physiological and pathological conditions.
25957287 Our results suggest that the CD34/CD25/CD123/CD99(+) LAIP is strictly associated with FLT3-ITD-positive cells.
25501132 The dAbd C7 induced rapid and massive EWS cell death through Mdm2 degradation and p53 reactivation. Mdm2 overexpression as well as silencing of p53 in p53wt EWS cells decreased CD99-induced EWS cell death
24798881 Report purification of human antibody scFv anti-CD99 for blocking monocyte transendothelial migration.
24797829 CD99 expression in astrocytomas of different malignant grades might contribute to the infiltrative ability and support the importance of CD99 as a potential target to reduce infiltrative astrocytoma capacity in migration and invasion.
24702676 CD99 expression in nasal lobular capillary haemangioma.
24677094 CD99 induces ERK activation, increasing its membrane-bound/cytoplasmic form rather than affecting its nuclear localization.
More...

AA Sequence

MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP      1 - 70
NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG     71 - 140
AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK                             141 - 185
//

Text Mined References (101)

PMID Year Title
26522646 2015 CD99 regulates CXCL12-induced chemotaxis of human plasma cells.
26172215 2015 CD99 inhibits CD98-mediated ?1 integrin signaling through SHP2-mediated FAK dephosphorylation.
26000982 2015 SEPTIN2 and STATHMIN Regulate CD99-Mediated Cellular Differentiation in Hodgkin's Lymphoma.
26000312 2015 Human myeloma cell lines induce osteoblast downregulation of CD99 which is involved in osteoblast formation and activity.
25957287 2015 A Leukemia-Associated CD34/CD123/CD25/CD99+ Immunophenotype Identifies FLT3-Mutated Clones in Acute Myeloid Leukemia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501132 2015 CD99 triggering in Ewing sarcoma delivers a lethal signal through p53 pathway reactivation and cooperates with doxorubicin.
24798881 2014 Blocking monocyte transmigration in in vitro system by a human antibody scFv anti-CD99. Efficient large scale purification from periplasmic inclusion bodies in E. coli expression system.
24797829 2014 CD99 is upregulated in placenta and astrocytomas with a differential subcellular distribution according to the malignancy stage.
24702676 2014 CD99 expression in nasal lobular capillary haemangioma.
More...