Property Summary

NCBI Gene PubMed Count 103
PubMed Score 465.97
PubTator Score 709.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.500 1.0e-03
astrocytic glioma 1.900 2.0e-02
Astrocytoma, Pilocytic 1.400 9.2e-05
atypical teratoid / rhabdoid tumor 1.100 4.2e-03
Breast cancer 1.400 1.1e-06
Down syndrome 1.800 1.0e-03
Duchenne muscular dystrophy 1.050 3.4e-11
ependymoma 2.300 1.1e-02
glioblastoma 1.300 2.0e-04
intraductal papillary-mucinous adenoma (... -1.900 4.3e-04
intraductal papillary-mucinous neoplasm ... -1.500 1.5e-02
limb girdle muscular dystrophy 2A 1.122 2.1e-07
lung cancer -1.600 9.4e-05
lung carcinoma -2.000 3.7e-22
oligodendroglioma 2.100 2.6e-02
osteosarcoma 1.136 4.2e-02
ovarian cancer -2.200 3.4e-08
pancreatic ductal adenocarcinoma liver m... -2.171 1.8e-02
pituitary cancer -2.000 2.1e-04
psoriasis -1.100 3.9e-02
Rheumatoid arthritis -1.400 1.6e-02

Gene RIF (69)

AA Sequence

MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP      1 - 70
NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG     71 - 140
AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK                             141 - 185
//

Text Mined References (108)

PMID Year Title