Property Summary

NCBI Gene PubMed Count 40
Grant Count 27
R01 Count 18
Funding $3,176,472.67
PubMed Score 82.15
PubTator Score 87.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.334 0.000
tuberculosis 1.100 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.002
breast carcinoma -1.100 0.026
interstitial cystitis 1.300 0.002
ductal carcinoma in situ -1.100 0.015
invasive ductal carcinoma -1.600 0.005

 MGI Term (1)

Gene RIF (23)

PMID Text
26248049 FR-beta expression was low or absent in the majority of ovarian, breast and colorectal tumor samples.
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25015955 FR-beta is uniquely expressed on this proinflammatory subpopulation offers a new strategy to suppress migration of inflammatory monocytes into sites of inflammation.
24206618 The FRalpha gene was expressed in all parathyroid cells analyzed, and the FRbeta gene was expressed by most.
23480364 severe pre-eclampsia is associated with decreased placental expression of FR-beta and a reduction in the number of fetal macrophages (Hofbauer cells)
23439585 High FOLR2 mRNA expression is associated with uraemic patients on hemodialysis.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of folate receptor 2 (FOLR2) in peptide-treated PBMCs
22350599 High Folate Receptor beta expressing tumor-associated macrophages are associated with pancreatic cancer.
22211358 Functional FR-beta present on osteoarthritis synovial macrophages provides a potential tool for the diagnosis and treatment of this disease.
22094710 Expression of folate receptor-beta on activated macrophages holds a promising potential for early diagnosis of atherosclerosis. (Review)
More...

AA Sequence

MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHK      1 - 70
DTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDC     71 - 140
HTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDS    141 - 210
AQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG                             211 - 255
//

Text Mined References (44)

PMID Year Title
26248049 2015 Folate Receptor-Beta Has Limited Value for Fluorescent Imaging in Ovarian, Breast and Colorectal Cancer.
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25015955 2014 Folate receptor-? constitutes a marker for human proinflammatory monocytes.
24206618 2013 Expression of functional folate receptors by human parathyroid cells.
23934049 2013 Structures of human folate receptors reveal biological trafficking states and diversity in folate and antifolate recognition.
23480364 2013 Decreased levels of folate receptor-? and reduced numbers of fetal macrophages (Hofbauer cells) in placentas from pregnancies with severe pre-eclampsia.
23439585 2013 Altered folate receptor 2 expression in uraemic patients on haemodialysis: implications for folate resistance.
22350599 2012 Clinical significance of folate receptor ?-expressing tumor-associated macrophages in pancreatic cancer.
22211358 2012 Functional folate receptor beta-expressing macrophages in osteoarthritis synovium and their M1/M2 expression profiles.
22094710 2012 Macrophage folate receptor-? (FR-?) expression in auto-immune inflammatory rheumatic diseases: a forthcoming marker for cardiovascular risk?
More...