Property Summary

Ligand Count 13
NCBI Gene PubMed Count 41
PubMed Score 88.58
PubTator Score 87.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.334 7.7e-05
breast carcinoma -1.100 2.6e-02
ductal carcinoma in situ -1.100 1.5e-02
interstitial cystitis 1.300 2.1e-03
intraductal papillary-mucinous adenoma (... -1.100 1.5e-03
invasive ductal carcinoma -1.600 4.6e-03
tuberculosis 1.100 2.0e-05

Gene RIF (24)

AA Sequence

MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHK      1 - 70
DTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDC     71 - 140
HTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDS    141 - 210
AQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG                             211 - 255
//

Text Mined References (45)

PMID Year Title