Property Summary

NCBI Gene PubMed Count 522
Grant Count 358
R01 Count 220
Funding $48,015,987.62
PubMed Score 1481.89
PubTator Score 1696.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P14174 A5Z1R8 B2R4S3 Q2V4Y5 Q6FHV0 MIF
Symbols GIF
GLIF
MMIF

Gene

MIF

PDB

1CA7   1CGQ   1GCZ   1GD0   1GIF   1LJT   1MIF   1P1G   2OOH   2OOW   2OOZ   3B9S   3CE4   3DJH   3DJI   3HOF   3IJG   3IJJ   3JSF   3JSG   3JTU   3L5P   3L5R   3L5S   3L5T   3L5U   3L5V   3SMB   3SMC   3U18   3WNR   3WNS   3WNT   4ETG   4EUI   4EVG   4F2K   4GRN   4GRO   4GRP   4GRQ   4GRR   4GRU   4GUM   4K9G   4OSF   4OYQ   4P01   4P0H   4PKK   4PKZ   4PLU   4TRF   4TRU   4WR8   4WRB   4XX7   4XX8   5B4O   5BS9   5BSC   5BSI   5BSJ   5CG4   5EIZ   5HVS   5HVT   5HVV   5J7P   5J7Q  

Gene RIF (528)

PMID Text
27049098 macrophage migration inhibitory factor is an important cell factor which plays a regulating role in the immune system, as it can inhibit macrophage migration and promote the gathering, infiltration and proliferation of macrophages at inflammatory sites.
26976591 strong evidence that carriage of high-expression MIF alleles is a genetic marker of morbidity and mortality of pneumococcal meningitis
26952810 Our data suggested that MIF affected the intrinsic properties of tumors and the host immune response in tumor microenvironment by regulating the TLR4/HMGB1 axis, leading to metastasis of breast cancer
26884830 miR-451 was down-regulated in renal cell carcinoma and correlated with histological grade and lymphatic metastasis. MIF was identified as a target of miR-451, and down-regulation of MIF could mimic the suppressive functions of miR-451.
26872252 The critical element of the Gremlin-1 molecule for regulating MIF-induced chemotactic activity lies at the C-terminal region. A single amino acid exchange of an arginine to an alanine residue is sufficient to abolish the antagonistic effect of Gremlin-1 on MIF. The Gremlin-1 mutant R172A failed to reduce MIF-induced monocyte differentiation into macrophages.
26858459 High expression levels of macrophage migration inhibitory factor sustain the innate immune responses of neonates.
26852939 Syndecan-1 on epithelial tumor cells promotes MIF binding and MIF-mediated cell migration. This may represent a relevant mechanism through which MIF enhances tumor cell motility and metastasis.
26829742 MIF -173CC and GPX1 594TT and high-fat diet are the risk factors for ulcerative colitis.
26825917 Our results suggested that the CC genotype and C allele of MIF rs755622 SNP may be a genetic marker for the risk of coronary artery disease (CAD) and potentially predict the severity of CAD in Chinese Kazakh population.
26752645 These findings identify ICBP90 as a key regulator of MIF transcription and provide functional insight into the regulation of the polymorphic MIF locus.
More...

AA Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG      1 - 70
AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA                              71 - 115
//

Text Mined References (533)

PMID Year Title
27049098 Correlation between genetic susceptibility of tuberculosis and macrophage migration inhibitory factor.
26976591 2016 Functional polymorphisms of macrophage migration inhibitory factor as predictors of morbidity and mortality of pneumococcal meningitis.
26952810 2016 Macrophage migration inhibitory factor promotes breast cancer metastasis via activation of HMGB1/TLR4/NF kappa B axis.
26884830 2015 microRNA-451 inhibited cell proliferation, migration and invasion through regulation of MIF in renal cell carcinoma.
26872252 2016 Gremlin-1 C-Terminus Regulates Function of Macrophage Migration Inhibitory Factor (MIF).
26858459 2016 High expression levels of macrophage migration inhibitory factor sustain the innate immune responses of neonates.
26852939 2016 Cell surface syndecan-1 contributes to binding and function of macrophage migration inhibitory factor (MIF) on epithelial tumor cells.
26829742 2016 [Interaction of MIF gene -173G/C polymorphism and GPX1 gene 594C/T polymorphism with high-fat diet in ulcerative colitis].
26825917 2016 MIF Gene Polymorphism rs755622 Is Associated With Coronary Artery Disease and Severity of Coronary Lesions in a Chinese Kazakh Population: A Case-Control Study.
26752645 2016 Transcription factor ICBP90 regulates the MIF promoter and immune susceptibility locus.
More...