Property Summary

NCBI Gene PubMed Count 178
Grant Count 613
R01 Count 346
Funding $85,348,823.06
PubMed Score 2781.00
PubTator Score 1483.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.974 0.016
astrocytic glioma 1.800 0.041
oligodendroglioma 3.000 0.009
uncontrolled asthma -1.200 0.015
cutaneous lupus erythematosus 4.000 0.000
osteosarcoma -2.911 0.014
glioblastoma 1.100 0.020
periodontitis 1.500 0.000
tuberculosis 1.700 0.000
non-small cell lung cancer -1.623 0.000
intraductal papillary-mucinous carcinoma... -1.400 0.012
lung cancer -3.600 0.000
interstitial cystitis 2.800 0.000
adult high grade glioma 1.200 0.027
pilocytic astrocytoma 1.300 0.002
primary Sjogren syndrome 3.100 0.000
psoriasis 2.300 0.000
invasive ductal carcinoma 1.700 0.048
lung carcinoma -2.600 0.000
ductal carcinoma in situ 2.100 0.023
acute myeloid leukemia -2.400 0.015
ulcerative colitis 3.700 0.000
ovarian cancer -2.500 0.000
pituitary cancer -2.600 0.000
dermatomyositis 1.600 0.034

Synonym

Accession P14151 B2R6Q8 P15023 Q9UJ43
Symbols TQ1
LAM1
LEU8
LNHR
LSEL
CD62L
LYAM1
PLNHR
LECAM1

Gene

PDB

1KJB   2LGF   3CFW  

 IMPC Term (1)

Gene RIF (176)

PMID Text
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26693907 freeze and thaw of murine and human Tregs is associated with reduced expression of L-selectin (CD62L), which was previously established to be an important factor that contributes to the in vivo protective effects of Tregs
26361072 While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26162407 Functional analyses revealed that the lymphocyte homing receptor L-selectin (CD62L) is the key factor controlling the binding of chronic lymphocytic leukemia cells to high endothelial venule walls in vivo.
25822027 Both Nef and Vpu associated with and sequestered CD62L in perinuclear compartments, thereby impeding CD62L transport to the plasma membrane.
25822027 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
25822027 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
25822027 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
25822027 HIV-1 Vpu inhibits the transport of newly synthesized CD62L molecules toward the cell surface of Jurkat cells
More...

AA Sequence

MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNK      1 - 70
AEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAG     71 - 140
KWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDC    141 - 210
THPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFS    211 - 280
FTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAF    281 - 350
IIWLARRLKKGKKSKRSMNDPY                                                    351 - 372
//

Text Mined References (182)

PMID Year Title
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26693907 2015 Freeze and Thaw of CD4+CD25+Foxp3+ Regulatory T Cells Results in Loss of CD62L Expression and a Reduced Capacity to Protect against Graft-versus-Host Disease.
26361072 2015 Human neutrophil antigen-3a antibodies induce neutrophil stiffening and conformational activation of CD11b without shedding of L-selectin.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26162407 2015 L-selectin controls trafficking of chronic lymphocytic leukemia cells in lymph node high endothelial venules in vivo.
25982478 2015 A novel splice variant of human L-selectin encodes a soluble molecule that is elevated in serum of patients with rheumatic diseases.
25822027 2015 HIV-1 Nef and Vpu Interfere with L-Selectin (CD62L) Cell Surface Expression To Inhibit Adhesion and Signaling in Infected CD4+ T Lymphocytes.
25618296 2015 Increased expression of L-selectin (CD62L) in high-grade urothelial carcinoma: A potential marker for metastatic disease.
25576479 2015 Multi-ethnic analysis reveals soluble L-selectin may be post-transcriptionally regulated by 3'UTR polymorphism: the Multi-Ethnic Study of Atherosclerosis (MESA).
25498912 2015 ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes.
More...