Property Summary

Ligand Count 4
NCBI Gene PubMed Count 186
PubMed Score 2829.94
PubTator Score 1483.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myocardial Infarction 151 0.0 0.0
Disease Target Count
IGA Glomerulonephritis 50
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 1.1

Expression

  Differential Expression (25)

Disease log2 FC p
tuberculosis 1.700 2.2e-05
acute myeloid leukemia -2.400 1.5e-02
adult high grade glioma 1.200 2.7e-02
astrocytic glioma 1.800 4.1e-02
Astrocytoma, Pilocytic 1.300 1.2e-03
cutaneous lupus erythematosus 4.000 1.2e-04
dermatomyositis 1.600 3.4e-02
ductal carcinoma in situ 2.100 2.3e-02
glioblastoma 1.100 2.0e-02
interstitial cystitis 2.700 1.5e-03
intraductal papillary-mucinous carcinoma... -1.400 1.2e-02
invasive ductal carcinoma 1.309 2.3e-03
lung cancer -3.600 1.7e-04
lung carcinoma -2.500 2.9e-15
non primary Sjogren syndrome sicca -1.100 2.5e-02
non-small cell lung cancer -1.623 4.6e-11
oligodendroglioma 3.000 9.0e-03
osteosarcoma -2.911 1.4e-02
ovarian cancer -2.500 3.6e-09
periodontitis 1.500 2.9e-30
pituitary cancer -2.600 4.7e-05
psoriasis 1.500 3.9e-24
ulcerative colitis 3.700 1.7e-06
uncontrolled asthma -1.200 1.5e-02
Waldenstrons macroglobulinemia 1.736 4.7e-02

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (178)

AA Sequence

MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNK      1 - 70
AEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAG     71 - 140
KWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDC    141 - 210
THPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFS    211 - 280
FTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAF    281 - 350
IIWLARRLKKGKKSKRSMNDPY                                                    351 - 372
//

Text Mined References (190)

PMID Year Title