Property Summary

NCBI Gene PubMed Count 200
PubMed Score 2828.66
PubTator Score 2448.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Leukodystrophy 55 0.0 4.0

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 2.300 4.9e-04
astrocytic glioma 2.100 1.1e-02
Astrocytoma, Pilocytic 3.000 7.9e-08
atypical teratoid / rhabdoid tumor -2.400 2.2e-03
Down syndrome 1.200 6.1e-03
ependymoma 1.900 3.7e-02
glioblastoma 1.400 2.4e-02
group 3 medulloblastoma -2.600 4.0e-05
inflammatory breast cancer -2.000 6.2e-04
medulloblastoma, large-cell -3.300 4.9e-03
oligodendroglioma 2.000 2.4e-02
pituitary cancer -2.200 3.1e-03

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (175)

AA Sequence

MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER      1 - 70
AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE     71 - 140
RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE    141 - 210
LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH    211 - 280
EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ    281 - 350
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV    351 - 420
IKESKQEHKDVM                                                              421 - 432
//

Text Mined References (211)

PMID Year Title