Property Summary

NCBI Gene PubMed Count 181
Grant Count 647
R01 Count 313
Funding $86,531,536.3
PubMed Score 2665.85
PubTator Score 2448.71

Knowledge Summary

Patent

No data available

Expression

Gene

Gene RIF (162)

PMID Text
26742791 This study demonistrated that the density of GFAP-immunoreactive astrocytes is decreased in left hippocampi in major depressive disorder
26547005 GFAP is significantly associated with outcome, but it does not add predictive power to commonly used prognostic variables in a population of patients with TBI of varying severities.
26526443 This study demonstrated that GFAP as a promising biomarker to distinguish ischemic stroke from intracerebral hemorrhage.
26485083 The levels of GFAP in Alzheimer's disease, dementia with Lewy bodies, and frontotemporal lobar degeneration patients were significantly higher than those in the healthy control subjects.
26279003 The data suggest that human vitreous body GFAP is a protein biomarker for glial activation in response to retinal pathologies.
26208460 Neither duplications nor deletions of GFAP were found, suggesting that GFAP coding-region rearrangements may not be involved in Alexander disease or Alexanderrelated leukoencephalopathies.
26081945 GFAP peaks early during haemorrhagic brain lesions (at significantly higher levels), and late in ischaemic events, whereas antibodies against NR2 RNMDA have significantly higher levels during ischemic stroke at all time-points.
25943894 HIV-1 clade B and C Tat upregulate the expression of GFAP in primary glia
25904356 There was an absence of GFAP in astrocytes during early fetal spinal cord development until 9 months of gestation , and the appearance of GFAP-positive reactivity was later than that of neurons.
25859599 The data on the changes in expression of GFAP in Alexander disease caused by the primary pathology of astrocytes are presented.
More...

AA Sequence

MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER      1 - 70
AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE     71 - 140
RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE    141 - 210
LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH    211 - 280
EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ    281 - 350
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV    351 - 420
IKESKQEHKDVM                                                              421 - 432
//

Text Mined References (192)

PMID Year Title
26742791 2016 Density of GFAP-immunoreactive astrocytes is decreased in left hippocampi in major depressive disorder.
26547005 2016 Glial Fibrillary Acidic Protein and Ubiquitin C-Terminal Hydrolase-L1 as Outcome Predictors in Traumatic Brain Injury.
26526443 2016 Plasmatic retinol-binding protein 4 and glial fibrillary acidic protein as biomarkers to differentiate ischemic stroke and intracerebral hemorrhage.
26485083 2016 Glial fibrillar acidic protein in the cerebrospinal fluid of Alzheimer's disease, dementia with Lewy bodies, and frontotemporal lobar degeneration.
26279003 2015 Elevated vitreous body glial fibrillary acidic protein in retinal diseases.
26208460 2015 Screening for GFAP rearrangements in a cohort of Alexander disease and undetermined leukoencephalopathy patients.
26081945 2015 GFAP and antibodies against NMDA receptor subunit NR2 as biomarkers for acute cerebrovascular diseases.
25904356 2015 Expression pattern of NeuN and GFAP during human fetal spinal cord development.
25859599 [Glial fibrillary acidic protein: the component of intermediate filaments in the vertebrate brain astrocytes].
25846779 2015 Elevated GFAP Protein in Anterior Cingulate Cortical White Matter in Males With Autism Spectrum Disorder.
More...