Property Summary

NCBI Gene PubMed Count 41
Grant Count 15
R01 Count 7
Funding $1,150,678.17
PubMed Score 223.46
PubTator Score 150.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
25348778 High Expression of Cathepsin E is associated with Tissues but Not Blood of Patients with Barrett's Esophagus and Adenocarcinoma.
25239563 Cathepsin E, mitochondrial fission, and caspase activation/apoptosis are linked in the pathogenesis of pulmonary emphysema.
24464956 Decreased activity of cathepsin E produced by decidual macrophages might be responsible for the induction of miscarriages in some recurrent miscarriage patients.
24242330 data demonstrate that CatE contributes to normal growth and development of mammary glands through proper trafficking and secretion of Wnt5a
23451082 CTSE is a marker of both gastric differentiation and signet-ring cell carcinoma, which should shed light on the mechanism of gastric tumorigenesis.
22718633 A comparative structure model of splice variant 2 was computed based on its alignment to the known structure of cathepsin E intermediate (Protein Data Bank code 1TZS) and used to rationalize its conformational properties and loss of activity.
22068166 Cath E activity is useful as a potential molecular target for Pancreatic ductal adenocarcinoma and early detection imaging.
21664991 Emerging roles of cathepsin E in immune system cells and skin keratinocytes, and in host defense against cancer cells.
20600629 Cath E selectivity was established by having -Leu**Pro- residues at the scissile peptide bond.
19172291 This study demonstrates the over-expression in CTSE, in particular, and TFF1 in sessile serrated adenomas compared to both hyperplastic polyps and tubular adenomas.
More...

AA Sequence

MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPL      1 - 70
INYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYG     71 - 140
TGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMM    141 - 210
AQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEG    211 - 280
CQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFV    281 - 350
DGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP                       351 - 401
//

Text Mined References (43)

PMID Year Title
25348778 2015 High Expression of Cathepsin E in Tissues but Not Blood of Patients with Barrett's Esophagus and Adenocarcinoma.
25239563 2014 Cathepsin E promotes pulmonary emphysema via mitochondrial fission.
24464956 2014 Role of cathepsin E in decidual macrophage of patients with recurrent miscarriage.
24242330 2014 Repression of cathepsin E expression increases the risk of mammary carcinogenesis and links to poor prognosis in breast cancer.
23451082 2013 Cathepsin E is a marker of gastric differentiation and signet-ring cell carcinoma of stomach: a novel suggestion on gastric tumorigenesis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22718633 2012 Biochemical characterization and structural modeling of human cathepsin E variant 2 in comparison to the wild-type protein.
22068166 2012 Detection of pancreatic cancer tumours and precursor lesions by cathepsin E activity in mouse models.
21664991 2012 Emerging roles of cathepsin E in host defense mechanisms.
20600629 2010 Selective detection of Cathepsin E proteolytic activity.
More...