Property Summary

NCBI Gene PubMed Count 134
Grant Count 33
R01 Count 27
Funding $2,357,528.9
PubMed Score 205.72
PubTator Score 202.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.700 0.000
non-small cell lung cancer 1.388 0.000
cystic fibrosis -1.200 0.000
lung adenocarcinoma 1.100 0.000

Gene RIF (103)

PMID Text
26261478 Review/Meta-analysis: HSD17B1 rs605059 polymorphisms were not associated with the risks of endometrial cancer or endometriosis.
26054693 the HSD17B1 transcript and protein were identified in HeLa, SiHa, Ca Ski and C-33A cervical cancer cells.
25617485 E1-induced ERELuc activity in the inhibitor-treated uterus was reduced by the HSD17B1 inhibitor.
25564397 Increased expression of HSD17B1 in NSCLC may contribute to an elevated intratissue level of E2 and consequently may support the development and spread of cancer.
25394609 The rs605059 polymorphism of the HSD17B1 gene is associated with increased risk of recurrent spontaneous abortion.
25257817 17beta-HSD1 and 17beta-HSD7 are principal reductive 17beta-hydroxysteroid dehydrogenases and major players in the viability of estrogen-dependent breast cancer cells.
24855493 The key enzymes of ovarian steroidogenesis, CYP 19 and 17beta-HSD, are active in the ovaries of postmenopausal women.
24563232 Single nucleotide polymorphism in HSD17B1 gene is associated with hepatocellular carcinoma.
24113171 Onset of epileptiform discharges is modestly delayed in slices from ovariectomized rats replaced with physiologically relevant doses of EB, but the number of discharges is not affected.
23916544 results demonstrated that HSD17B1 expression and its ability to convert the weak estrogen E1 to the more potent E2 can be associated with DNA methylation in the 5' flanking region in GC cells.
More...

AA Sequence

MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDS      1 - 70
KSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLV     71 - 140
TGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDI    141 - 210
HTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAM    211 - 280
HREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRGAVGDPELGDPPAAPQ                          281 - 328
//

Text Mined References (137)

PMID Year Title
27571989 2016 17?-hydroxysteroid dehydrogenase type Gene 1937 A > G Polymorphism as a Risk Factor for Cervical Cancer Progression in the Polish Population.
27544780 2017 Estradiol-independent modulation of breast cancer transcript profile by 17beta-hydroxysteroid dehydrogenase type 1.
27102893 2016 Current knowledge of the multifunctional 17?-hydroxysteroid dehydrogenase type 1 (HSD17B1).
26923943 2016 Polymorphism of HSD17B1 Ser312Gly with Cancer Risk: Evidence from 66,147 Subjects.
26323233 2015 Polymorphisms in CYP19A1, HSD17B1 and HSD17B2 genes and serum sex hormone level among postmenopausal Japanese women.
26261478 2015 Association between HSD17B1 rs605059 polymorphisms and the risk of uterine diseases: a systemic review and meta-analysis.
26054693 2015 Increased 17ß-hydroxysteroid dehydrogenase type 1 levels in primary cervical cancer.
25617485 2015 HSD17B1 expression enhances estrogen signaling stimulated by the low active estrone, evidenced by an estrogen responsive element-driven reporter gene in vivo.
25564397 2015 Increased expression of 17-beta-hydroxysteroid dehydrogenase type 1 in non-small cell lung cancer.
25394609 2015 Evidence for association of the rs605059 polymorphism of HSD17B1 gene with recurrent spontaneous abortions.
More...