Property Summary

Ligand Count 271
NCBI Gene PubMed Count 141
PubMed Score 220.76
PubTator Score 202.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.100 2.5e-03
lung adenocarcinoma 1.100 1.4e-04
non-small cell lung cancer 1.388 7.0e-12
psoriasis 1.400 2.2e-03

 GWAS Trait (1)

Protein-protein Interaction (12)

Gene RIF (112)

AA Sequence

MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDS      1 - 70
KSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLV     71 - 140
TGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDI    141 - 210
HTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAM    211 - 280
HREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRGAVGDPELGDPPAAPQ                          281 - 328
//

Text Mined References (144)

PMID Year Title