Property Summary

NCBI Gene PubMed Count 92
Grant Count 48
R01 Count 28
Funding $3,478,443.23
PubMed Score 345.16
PubTator Score 426.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -3.600 0.000

Protein-protein Interaction (4)

Gene RIF (78)

PMID Text
25731771 prostate cancer patients who harbored the heterozygous variant HSD3B1 (1245C) are more likely to develop to castration-resistant prostate cancer but do not have shorter time to biochemical recurrence, shorter survival time or higher mortality risk
25458695 HSD3B1 is involved in aldosterone production, despite its lower levels of expression compared with HSD3B2, and also possibly associated with KCNJ5 mutation in aldosterone-producing adenoma.
25319929 Results indicate that orexin-A significantly enhanced the expression of 3beta-hydroxysteroid dehydrogenase (3beta-HSD) and the production of cortisol, and increased the phosphorylation of AKT protein in the NCI-H295R adrenocortical cells.
25172194 The data of this study supports a strongly positive association between mitochondrial complex I gene variations and MS pathogenesis in a Filipino population.
25092869 The AngII-NGFIB/NURR1 pathway controls HSD3B1 expression.
24951726 No evidence to support that HSD3B1 is involved in aldosterone synthesis in the human adrenal cortex or that genetic variation in HSD3B1 affects blood pressure or hypertension.
24810473 Expression of the genes HSD3B1, HSD17B3, and SRD5A2 was significantly increased in BPH tissues compared to normal adjacent prostate tissues.
24157973 The AAT haplotype of the HSD3B1 gene was significantly associated with increased risks of acne vulgaris in Han Chinese from the Southwest China.
24006038 Risk-conferring genetic variations in the HSD3beta gene influenced susceptibility of primary aldosteronism. Concomitant presence of rs6203 CC and rs12410453 GA genotypes synergistically increased aldosterone-to-renin ratio
23993097 Study shows that castration-resistant prostate cancer sometimes expresses a gain-of-stability mutation that leads to a gain-of-function in 3betaHSD1, which catalyzes the initial rate-limiting step in conversion of the adrenal-derived steroid dehydroepiandrosterone to dihydrotestosterone.
More...

AA Sequence

MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLK      1 - 70
RACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQN     71 - 140
GHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNG    141 - 210
ILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRL    211 - 280
DSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAK    281 - 350
QKTVEWVGSLVDRHKETLKSKTQ                                                   351 - 373
//

Publication (93)

PMID Year Title
25731771 2015 Variant allele of HSD3B1 increases progression to castration-resistant prostate cancer.
25458695 2015 3?-Hydroxysteroid dehydrogenase isoforms in human aldosterone-producing adenoma.
25319929 2014 Orexin-A stimulates 3?-hydroxysteroid dehydrogenase expression and cortisol production in H295R human adrenocortical cells through the AKT pathway.
25172194 2014 Mitochondrial complex I gene variations; as a potential genetic risk factor in pathogenesis of multiple sclerosis.
25092869 2014 Angiotensin II triggers expression of the adrenal gland zona glomerulosa-specific 3?-hydroxysteroid dehydrogenase isoenzyme through de novo protein synthesis of the orphan nuclear receptors NGFIB and NURR1.
24951726 2015 Expression and gene variation studies deny association of human HSD3B1 gene with aldosterone production or blood pressure.
24810473 2015 Gene expression of androgen metabolising enzymes in benign and malignant prostatic tissues.
24157973 2013 Association of HSD17B3 and HSD3B1 polymorphisms with acne vulgaris in Southwestern Han Chinese.
24006038 2013 Association of the variations in the HSD3? gene with primary aldosteronism.
23993097 2013 A gain-of-function mutation in DHT synthesis in castration-resistant prostate cancer.
More...