Property Summary

Ligand Count 13
NCBI Gene PubMed Count 93
PubMed Score 370.75
PubTator Score 426.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 3.7e-03

Gene RIF (79)

AA Sequence

MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLK      1 - 70
RACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQN     71 - 140
GHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNG    141 - 210
ILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRL    211 - 280
DSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAK    281 - 350
QKTVEWVGSLVDRHKETLKSKTQ                                                   351 - 373
//

Text Mined References (94)

PMID Year Title