Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.32
PubTator Score 15.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Hodgkin Disease 16
Disease Target Count P-value
astrocytoma 1493 1.72071352735469E-30
breast carcinoma 1614 4.80395627237631E-26
oligodendroglioma 2849 3.9157117248297E-17
non-small cell lung cancer 2798 4.91070960723311E-17
juvenile dermatomyositis 1189 4.90720738750456E-11
ulcerative colitis 2087 5.90816942491841E-9
osteosarcoma 7933 7.06968416653759E-8
acute quadriplegic myopathy 1157 1.08739784479085E-7
medulloblastoma, large-cell 6234 3.11716467241509E-7
Amyotrophic Lateral Sclerosis 432 3.76497638709084E-7
malignant mesothelioma 3163 7.65709058174829E-7
Breast cancer 3099 8.87103385264188E-7
lung adenocarcinoma 2714 2.15085673409678E-6
sonic hedgehog group medulloblastoma 1482 5.18055262456654E-6
lung cancer 4473 3.01396558351444E-5
colon cancer 1475 3.90547097292327E-5
psoriasis 6685 4.97361167272224E-5
ductal carcinoma in situ 1745 9.21534674428229E-5
pilocytic astrocytoma 3086 1.50005131160034E-4
adrenocortical carcinoma 1427 1.94403051476802E-4
invasive ductal carcinoma 2950 2.03661715152439E-4
nasopharyngeal carcinoma 1056 2.22587958917596E-4
adult high grade glioma 2148 2.51385167911946E-4
glioblastoma 5572 3.82058518635117E-4
interstitial cystitis 2299 7.68697420303266E-4
pituitary cancer 1972 8.34306212003801E-4
primitive neuroectodermal tumor 3031 9.34082715360153E-4
atypical teratoid/rhabdoid tumor 1095 0.00130675124730093
pancreatic cancer 2300 0.00158640936218611
ovarian cancer 8492 0.00324706677902686
head and neck cancer 270 0.00527391883242087
active Crohn's disease 918 0.00743839092528914
diabetes mellitus 1663 0.00799648866534507
Polycystic Ovary Syndrome 335 0.012328477657141
dermatomyositis 967 0.0155273686696885
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0177976714336802
esophageal adenocarcinoma 737 0.0286335583284349
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0310210496899534

Expression

Synonym

Accession P13995 Q53G90 Q53GV5 Q53S36 Q7Z650
Symbols NMDMC

Gene

PANTHER Protein Class (2)

PDB

1ZN4  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (16)

PMID Text
26461067 These findings suggest a previously unknown role for MTHFD2 in cancer cell proliferation, adding to its known function in mitochondrial folate metabolism.
24870594 Data indicate that methylenetetrahydrofolate dehydrogenase (NADP + -dependent) 2 (MTHFD2)was differentially expressed in breast cancer tissue, suggesting as a prognostic factor and a potential therapeutic target for future breast cancer treatments.
24451681 The highest scoring pathway is mitochondrial one-carbon metabolism and is centred on MTHFD2.
23295955 Data indicate that the reduced vimentin expression in response to EPHB4, WIPF2 and MTHFD2 silencing was observed at mRNA and protein levels.
22190034 HIV-1 Nef is identified to have a physical interaction with methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 (MTHFD2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAATSLMSALAARLLQPAHSCSLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHL      1 - 70
SVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHID     71 - 140
ERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIA    141 - 210
MLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVH    211 - 280
DPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN    281 - 350
//

Text Mined References (33)

PMID Year Title
26461067 2015 The folate-coupled enzyme MTHFD2 is a nuclear protein and promotes cell proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24870594 2014 Increased MTHFD2 expression is associated with poor prognosis in breast cancer.
24451681 2014 Metabolic enzyme expression highlights a key role for MTHFD2 and the mitochondrial folate pathway in cancer.
23295955 2013 High-throughput RNAi screening for novel modulators of vimentin expression identifies MTHFD2 as a regulator of breast cancer cell migration and invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...