Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.32
PubTator Score 15.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P13995 Q53G90 Q53GV5 Q53S36 Q7Z650
Symbols NMDMC

Gene

PANTHER Protein Class (2)

PDB

1ZN4  

Gene RIF (16)

PMID Text
26461067 These findings suggest a previously unknown role for MTHFD2 in cancer cell proliferation, adding to its known function in mitochondrial folate metabolism.
24870594 Data indicate that methylenetetrahydrofolate dehydrogenase (NADP + -dependent) 2 (MTHFD2)was differentially expressed in breast cancer tissue, suggesting as a prognostic factor and a potential therapeutic target for future breast cancer treatments.
24451681 The highest scoring pathway is mitochondrial one-carbon metabolism and is centred on MTHFD2.
23295955 Data indicate that the reduced vimentin expression in response to EPHB4, WIPF2 and MTHFD2 silencing was observed at mRNA and protein levels.
22190034 HIV-1 Nef is identified to have a physical interaction with methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 (MTHFD2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAATSLMSALAARLLQPAHSCSLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHL      1 - 70
SVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHID     71 - 140
ERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIA    141 - 210
MLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVH    211 - 280
DPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN    281 - 350
//

Text Mined References (33)

PMID Year Title
26461067 2015 The folate-coupled enzyme MTHFD2 is a nuclear protein and promotes cell proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24870594 2014 Increased MTHFD2 expression is associated with poor prognosis in breast cancer.
24451681 2014 Metabolic enzyme expression highlights a key role for MTHFD2 and the mitochondrial folate pathway in cancer.
23295955 2013 High-throughput RNAi screening for novel modulators of vimentin expression identifies MTHFD2 as a regulator of breast cancer cell migration and invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...