Property Summary

Ligand Count 1
NCBI Gene PubMed Count 33
PubMed Score 24.91
PubTator Score 15.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hodgkin Disease 15 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (38)

Disease log2 FC p
active Crohn's disease 1.489 7.4e-03
active ulcerative colitis 1.093 1.3e-02
acute quadriplegic myopathy 2.583 1.1e-07
adrenocortical carcinoma 1.565 1.9e-04
adult high grade glioma 2.000 2.5e-04
Amyotrophic lateral sclerosis 1.622 3.8e-07
astrocytic glioma 2.700 3.4e-02
Astrocytoma, Pilocytic 1.600 1.3e-04
atypical teratoid / rhabdoid tumor 1.200 4.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.012 1.8e-02
Breast cancer 1.600 8.9e-07
breast carcinoma 1.100 8.8e-05
colon cancer 1.100 3.9e-05
dermatomyositis 1.700 1.6e-02
diabetes mellitus -1.200 8.0e-03
ductal carcinoma in situ 1.800 9.2e-05
esophageal adenocarcinoma 1.300 2.9e-02
glioblastoma 1.500 7.0e-06
head and neck cancer 1.200 5.3e-03
interstitial cystitis 2.000 7.7e-04
invasive ductal carcinoma 1.900 2.0e-04
juvenile dermatomyositis 1.767 4.9e-11
lung adenocarcinoma 1.200 2.2e-06
lung cancer 2.300 3.1e-05
malignant mesothelioma 1.500 7.7e-07
medulloblastoma 1.300 2.7e-02
medulloblastoma, large-cell 3.000 3.1e-07
nasopharyngeal carcinoma 1.400 2.2e-04
non-small cell lung cancer 1.380 4.9e-17
oligodendroglioma 2.700 2.9e-02
osteosarcoma 2.228 3.4e-04
ovarian cancer 1.800 4.3e-04
pancreatic cancer -1.800 1.6e-03
pancreatic ductal adenocarcinoma liver m... 1.987 3.1e-02
pituitary cancer -2.300 8.3e-04
Polycystic ovary syndrome -1.258 1.2e-02
primitive neuroectodermal tumor 1.200 9.3e-04
psoriasis 2.300 5.0e-05

Protein-protein Interaction (5)

Gene RIF (20)

AA Sequence

MAATSLMSALAARLLQPAHSCSLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHL      1 - 70
SVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHID     71 - 140
ERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIA    141 - 210
MLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVH    211 - 280
DPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN    281 - 350
//

Text Mined References (39)

PMID Year Title