Property Summary

NCBI Gene PubMed Count 8
PubMed Score 116.52
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

 Compartment GO Term (2)

AA Sequence

MGERKGVNKYYPPDFNPEKHGSLNRYHNSHPLRERARKLSQGILIIRFEMPYNIWCDGCKNHIGMGVRYN      1 - 70
AEKKKVGNYYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGAQRKEERWDMADNEQVLTTEHEKKQK     71 - 140
LETDAMFRLEHGEADRSTLKKALPTLSHIQEAQSAWKDDFALNSMLRRRFREKKKAIQEEEERDQALQAK    141 - 210
ASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRR    211 - 280
TALATSPITVGDLGIVRRRSRDVPESPQHAADTPKSGEPRVPEEAAQDRPMSPGDCPPETTETPKCSSPR    281 - 350
GQEGSRQDKPLSPAGSSQEAADTPDTRHPCSLGSSLVADYSDSESE                            351 - 396
//

Text Mined References (10)

PMID Year Title