Property Summary

NCBI Gene PubMed Count 171
Grant Count 286
R01 Count 188
Funding $42,489,063.94
PubMed Score 1768.58
PubTator Score 17471.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 2.007 0.007
malignant mesothelioma -1.900 0.000
esophageal adenocarcinoma -1.200 0.028
psoriasis -1.500 0.000
osteosarcoma -1.184 0.018
group 4 medulloblastoma -1.500 0.000
glioblastoma 1.200 0.017
medulloblastoma, large-cell -2.800 0.000
lung cancer -1.600 0.000
breast carcinoma -1.100 0.000
pilocytic astrocytoma 1.500 0.000
inflammatory breast cancer -1.100 0.040
spina bifida -1.064 0.045
acute myeloid leukemia -1.200 0.022
ovarian cancer -2.400 0.000
Down syndrome 1.300 0.003

Synonym

Accession P13987
Symbols 1F5
EJ16
EJ30
EL32
G344
MIN1
MIN2
MIN3
MIRL
HRF20
MACIF
MEM43
MIC11
MSK21
16.3A5
HRF-20
MAC-IP
p18-20

Gene

PDB

1CDQ   1CDR   1CDS   1ERG   1ERH   2J8B   2OFS   2UWR   2UX2   4BIK   5IMT   5IMY  

 GO Function (1)

Gene RIF (114)

PMID Text
26978230 Decreased CD59 expression in threatened miscarriage at late gestational ages leads to additional activation of a maternal immune response and serves as a possible predictor for premature birth.
26772976 Urinary CD59 and alpha-1 antitrypsin are significantly altered in hypertensive patients developing albuminuria.
26738794 Increased internalization of endothelial CD59 in intermittent hypoxia appeared to be cholesterol-dependent and was reversed by statins in a CD59-dependent manner.
26686775 levels of CSF CD59 in neuromyelitis optica and multiple sclerosis
26420021 Low urine CD59 expression is associated with clear cell renal cell carcinoma.
26271970 Data show that the palmitoylation mutation of linker for activation of T cells (LAT)attenuated the signal transduction induced by glycosylphosphatidylinositol-anchored CD59 antigen in T cells.
26218915 Genetic risk at the CFH-to-F13B locus was associated with higher levels of complement activation at the human macular RPE-choroid interface, as was cigarette smoking. Levels of CRP were substantially elevated in risk donors with smoking history.
26136568 After blockage of CD59 function, the reactive Abs, regardless of their neutralizing activities, significantly enhanced specific ADCML of HIV-1 virions
26109641 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25818314 A primary homozygous Cys89Tyr CD59 deficiency in humans resulted in the amino acid substitution p.Cys89Tyr with ensuing failure of proper localization of the CD59 protein to the cell surface. (Review)
More...

AA Sequence

MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC      1 - 70
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP                 71 - 128
//

Text Mined References (176)

PMID Year Title
26978230 [Immunomorphological aspects of miscarriage at late gestational ages].
26772976 2016 Urinary alpha-1 antitrypsin and CD59 glycoprotein predict albuminuria development in hypertensive patients under chronic renin-angiotensin system suppression.
26738794 2016 Increased internalization of complement inhibitor CD59 may contribute to endothelial inflammation in obstructive sleep apnea.
26686775 2016 Increased levels of CSF CD59 in neuromyelitis optica and multiple sclerosis.
26420021 2016 Proteomic analysis reveals differentially secreted proteins in the urine from patients with clear cell renal cell carcinoma.
26271970 2015 [Mutation of palmitoylation site of linker for activation of T cells inhibits signal transduction mediated by glycosyl phosphatidyl inositol-anchored CD59 in T cells].
26218915 2015 Assessment of Proteins Associated With Complement Activation and Inflammation in Maculae of Human Donors Homozygous Risk at Chromosome 1 CFH-to-F13B.
26136568 2015 Blockage of CD59 Function Restores Activities of Neutralizing and Nonneutralizing Antibodies in Triggering Antibody-Dependent Complement-Mediated Lysis of HIV-1 Virions and Provirus-Activated Latently Infected Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25818314 2015 Paroxysmal nocturnal hemoglobinuria (PNH) and primary p.Cys89Tyr mutation in CD59: Differences and similarities.
More...