Property Summary

NCBI Gene PubMed Count 184
PubMed Score 1829.92
PubTator Score 17471.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.200 2.2e-02
Astrocytoma, Pilocytic 1.500 2.4e-08
breast carcinoma -1.100 5.0e-05
Down syndrome 1.300 2.9e-03
esophageal adenocarcinoma -1.100 2.9e-02
glioblastoma 1.200 1.7e-02
group 4 medulloblastoma -1.500 5.6e-07
inflammatory breast cancer -1.100 4.0e-02
lung cancer -1.100 2.0e-03
malignant mesothelioma -1.900 7.9e-08
medulloblastoma, large-cell -1.800 6.0e-05
Multiple myeloma 1.209 9.9e-03
osteosarcoma -1.184 1.8e-02
ovarian cancer -1.200 4.2e-04
psoriasis -1.100 4.1e-03
spina bifida -1.064 4.5e-02

 GO Function (1)

Protein-protein Interaction (1)

C9  

Gene RIF (124)

AA Sequence

MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC      1 - 70
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP                 71 - 128
//

Text Mined References (189)

PMID Year Title