Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 11.50

Knowledge Summary

Patent

No data available

Synonym

Accession P13985
Symbols HRES-1
HRES-1/p28

Gene

 Compartment GO Term (0)

Gene RIF (5)

AA Sequence

MRCAHAPAPRTRYPTRAPSGPRPPSRSQAQTPPRSVPRLRPRHRHPQDPRSPGPAPRHRRPPRPDPRAPP      1 - 70
ARASYRRFRTWPSATSWERRRLSPGHRALARGPPARLGGEGPGAGDRRREGPDRSPRQPPVLPAAAAQPD     71 - 140
SSSAQAPGPSTLRPAATARRKRRWATRGPAHPAFARAHGEAGAGRVRTSARAGSTCAGWALWRCALRWAE    141 - 210
RQVGALGAESRFP                                                             211 - 223
//

Text Mined References (17)

PMID Year Title