Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 11.50

Knowledge Summary

Patent

No data available

Synonym

Accession P13985
Symbols HRES-1
HRES-1/p28

Gene

 Compartment GO Term (0)

Gene RIF (5)

PMID Text
20161734 Meta-analysis of gene-disease association. (HuGE Navigator)
20110814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18240231 The HRES-1 locus represents a recombination hot spot at the 1q42 chromosomal region that influences the development and disease manifestations of systemic lupus erythematosus
18240231 Observational study of gene-disease association. (HuGE Navigator)
12512743 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MRCAHAPAPRTRYPTRAPSGPRPPSRSQAQTPPRSVPRLRPRHRHPQDPRSPGPAPRHRRPPRPDPRAPP      1 - 70
ARASYRRFRTWPSATSWERRRLSPGHRALARGPPARLGGEGPGAGDRRREGPDRSPRQPPVLPAAAAQPD     71 - 140
SSSAQAPGPSTLRPAATARRKRRWATRGPAHPAFARAHGEAGAGRVRTSARAGSTCAGWALWRCALRWAE    141 - 210
RQVGALGAESRFP                                                             211 - 223
//

Text Mined References (17)

PMID Year Title
24117194 2014 DNA methylation modulates HRES1/p28 expression in B cells from patients with Lupus.
20161734 2010 Causal relationship of susceptibility genes to ischemic stroke: comparison to ischemic heart disease and biochemical determinants.
20110814 2010 Air pollution and homocysteine: more evidence that oxidative stress-related genes modify effects of particulate air pollution.
18432409 2008 Molecular mimicry and immunomodulation by the HRES-1 endogenous retrovirus in SLE.
18240231 2008 Haplotypes of the HRES-1 endogenous retrovirus are associated with development and disease manifestations of systemic lupus erythematosus.
15894513 2005 Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoantigen in patients with systemic lupus erythematosus.
12512743 2002 HFE mutations and hemochromatosis in Danish patients admitted for HFE genotyping.
11327721 2001 Molecular analysis of endogenous retrovirus HRES-1: identification of frameshift mutations in region encoding putative 28-kDa autoantigen.
10436175 1999 Polymorphic genotypes of the HRES-1 human endogenous retrovirus locus correlate with systemic lupus erythematosus and autoreactivity.
10433076 1999 A novel haplotype of the endogenous retrovirus, HRES-1, in patients with multiple sclerosis and healthy individuals.
More...