Property Summary

NCBI Gene PubMed Count 316
Grant Count 114
R01 Count 71
Funding $11,031,242.51
PubMed Score 550.21
PubTator Score 632.85

Knowledge Summary

Patent (13,551)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 0.001

Synonym

Accession P13945 Q4JFT4
Symbols BETA3AR

Gene

PANTHER Protein Class (2)

PDB

2CDW  

  TechDev Info (1)

Gene RIF (363)

PMID Text
26617941 ADRB3 expression correlated strongly with overactive bladder related symptoms.
26602921 our result suggested complex interactions amongst the studied SNPs and ADRB3 rs4994 as candidate influencing GBC susceptibility.
26410938 Genetic association of ADRB3 single nucleotide polymorphism with metabolic syndrome among the Tatars
25928572 Trp64Arg polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population
25867395 Meta-analysis: Trp64Arg polymorphism in the beta3-AR gene is involved in the pathogenesis of overactive bladder.
25827163 Study tested the association of peroxisome proliferator-activated receptor and beta3-AR polymorphisms with metabolic, nutritional, and blood pressure parameters in 271 postmenopausal women
25800470 W64R Polymorphism in the adrenergic beta-3- receptor is not associated with obesity and waist-to-hip ratio.
25636111 T190C variation of the beta3-AR gene was not associated with increased risk for chronic heart failure
25081806 Carriers of the ADRB3 Arg64 allele had a significantly higher relative body weight and relative body mass index compared with non-carriers.
25059067 The results of these studies suggest that genetic variants of the FTO gene rs9939609 genotype and Trp64Arg ADRB3 contribute to the development of obesity among residents of Moscow and Sverdlovsk Region of Russia.
More...

AA Sequence

MAPWPHENSSLAPWPDLPTLAPNTANTSGLPGVPWEAALAGALLALAVLATVGGNLLVIVAIAWTPRLQT      1 - 70
MTNVFVTSLAAADLVMGLLVVPPAATLALTGHWPLGATGCELWTSVDVLCVTASIETLCALAVDRYLAVT     71 - 140
NPLRYGALVTKRCARTAVVLVWVVSAAVSFAPIMSQWWRVGADAEAQRCHSNPRCCAFASNMPYVLLSSS    141 - 210
VSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPA    211 - 280
RLLPLREHRALCTLGLIMGTFTLCWLPFFLANVLRALGGPSLVPGPAFLALNWLGYANSAFNPLIYCRSP    281 - 350
DFRSAFRRLLCRCGRRLPPEPCAAARPALFPSGVPAARSSPAQPRLCQRLDGASWGVS                351 - 408
//

Text Mined References (317)

PMID Year Title
26617941 2015 Beta-3 adrenergic receptors could be significant factors for overactive bladder-related symptoms.
26602921 2015 A Multiple Interaction Analysis Reveals ADRB3 as a Potential Candidate for Gallbladder Cancer Predisposition via a Complex Interaction with Other Candidate Gene Variations.
26410938 2015 [Genetic Association of ADRA2A and ADRB3 Genes with Metabolic Syndrome among the Tatars].
25928572 2015 Effect of the beta-3 adrenergic receptor Trp64Arg and uncoupling protein 1-3826 A>G genotypes on lipid and apolipoprotein levels in overweight/obese and non-obese Chinese subjects.
25867395 2015 Association between polymorphism of ?3-adrenoceptor gene and overactive bladder: a meta-analysis.
25827163 2015 Association of PPAR-?2 and ?3-AR Polymorphisms With Postmenopausal Hypertension.
25800470 2015 ?-3AR W64R Polymorphism and 30-Minute Post-Challenge Plasma Glucose Levels in Obese Children.
25636111 2015 [Association of T190C polymorphism of ?3 adrenergic receptor gene with response to carvedilol in patients with chronic heart failure].
25081806 Effects of energy expenditure gene polymorphisms on obesity-related traits in obese children.
25059067 2014 [Regional features of obesity-associated gene polymorphism (rs9939609 FTO gene and gene Trp64Arg ADRB3) in Russian population].
More...