Property Summary

Ligand Count 217
NCBI Gene PubMed Count 323
PubMed Score 568.37
PubTator Score 632.85

Knowledge Summary

Patent (13,551)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 1.1e-03

Gene RIF (370)

AA Sequence

MAPWPHENSSLAPWPDLPTLAPNTANTSGLPGVPWEAALAGALLALAVLATVGGNLLVIVAIAWTPRLQT      1 - 70
MTNVFVTSLAAADLVMGLLVVPPAATLALTGHWPLGATGCELWTSVDVLCVTASIETLCALAVDRYLAVT     71 - 140
NPLRYGALVTKRCARTAVVLVWVVSAAVSFAPIMSQWWRVGADAEAQRCHSNPRCCAFASNMPYVLLSSS    141 - 210
VSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPA    211 - 280
RLLPLREHRALCTLGLIMGTFTLCWLPFFLANVLRALGGPSLVPGPAFLALNWLGYANSAFNPLIYCRSP    281 - 350
DFRSAFRRLLCRCGRRLPPEPCAAARPALFPSGVPAARSSPAQPRLCQRLDGASWGVS                351 - 408
//

Text Mined References (324)

PMID Year Title