Property Summary

NCBI Gene PubMed Count 18
PubMed Score 247.27
PubTator Score 22.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN      1 - 70
NTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN     71 - 140
PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE    141 - 210
GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY    211 - 280
KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV    281 - 350
TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK    351 - 420
AIFAGRKFRNPKAK                                                            421 - 434
//

Text Mined References (24)

PMID Year Title