Property Summary

NCBI Gene PubMed Count 17
Grant Count 13
Funding $3,287,761.73
PubMed Score 235.83
PubTator Score 22.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25918939 tRK1 forms a complex with human enolases and interacts with tRK1 and human pre-lysyl-tRNA synthetase (preKARS2)
25267339 Molecular genetic analysis of ENO3 gene revealed two novel homozygous missense mutations, (p.Asn151Ser and p.Glu187Lys)in patients presenting with recurrent rhabdomyolysis.
21347838 Pyridoxamine and carnosine protected enolase against the total loss of catalytic activity.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19472918 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN      1 - 70
NTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN     71 - 140
PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE    141 - 210
GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY    211 - 280
KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV    281 - 350
TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK    351 - 420
AIFAGRKFRNPKAK                                                            421 - 434
//

Text Mined References (23)

PMID Year Title
25918939 2015 A Moonlighting Human Protein Is Involved in Mitochondrial Import of tRNA.
25267339 2014 Recurrent rhabdomyolysis due to muscle ?-enolase deficiency: very rare or underestimated?
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21347838 2011 Glycation of the muscle-specific enolase by reactive carbonyls: effect of temperature and the protection role of carnosine, pyridoxamine and phosphatidylserine.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
More...