Property Summary

Ligand Count 639
NCBI Gene PubMed Count 92
PubMed Score 723.33
PubTator Score 321.59

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.255 4.0e-03
active ulcerative colitis 1.594 8.4e-03
Breast cancer -1.300 1.4e-04
intraductal papillary-mucinous neoplasm ... 2.000 2.9e-02
lung adenocarcinoma -1.200 1.2e-08
lung cancer 1.900 1.0e-03
lung carcinoma -1.100 5.2e-11
ovarian cancer 1.300 1.4e-05
psoriasis 2.200 5.7e-12

Gene RIF (71)

AA Sequence

KMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA                                        631 - 664

Text Mined References (93)

PMID Year Title