Property Summary

NCBI Gene PubMed Count 85
Grant Count 141
R01 Count 118
Funding $19,012,878.76
PubMed Score 559.02
PubTator Score 321.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 2.200 0.000
intraductal papillary-mucinous neoplasm ... 2.000 0.029
lung cancer 1.900 0.001
active Crohn's disease 1.255 0.004
ulcerative colitis 1.900 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.100 0.000
Breast cancer -1.400 0.000
ovarian cancer 1.300 0.000

Synonym

Accession P13866 B2R7E2 B7Z4Q9 B7ZA69 Na(+)/glucose cotransporter 1
Symbols NAGT
SGLT1
D22S675

Gene

PANTHER Protein Class (2)

Gene RIF (64)

PMID Text
26945065 Although the similarity between the pf values of SGLT1 and aquaporin-1 makes a transcellular pathway plausible, it renders water pumping physiologically negligible because the passive flux would be orders of magnitude larger.
26377793 Data demonstrate a role for Per1 in the transcriptional regulation of NHE3 and SGLT1 in the kidney.
26316524 Elevated SGLT activity increases Na+ influx into myocytes and causes Na+ overload in type 2 diabetes.
26121582 Cardiac SGLTs, possibly SGLT1 in particular, appear to provide an important protective mechanism against ischemia-reperfusion injury by replenishing ATP stores in ischemic cardiac tissues.
26086341 phlorizin binding domains in sodium-glucose cotransporter family
25936754 CREB activation is essential for EGF-induced SGLT1 gene expression.
25711084 SGLT1 or GLUT2 interact with the cytoskeleton in the intestinal epithelium during hexose absorption.
25600494 Compound K induces SGLT1 expression and glucose uptake in differentiated intestinal Caco-2 cells.
24236070 SGLT1 mRNA and GLUT2 mRNA expression are reduced significantly in CACo-2 cells exposed to berry extracts.
24191006 The Na2 site is conserved in hSGLT1, the side chain of S392 and the backbone carbonyl of S393 are important in the first Na+ binding, and that Na+ binding to Na2 promotes binding to Na1 and also sugar binding.
More...

AA Sequence

MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPI      1 - 70
GASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQR     71 - 140
IQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVI    141 - 210
MLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFI    211 - 280
FGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSE    281 - 350
CEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK    351 - 420
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLI    421 - 490
LGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLC    491 - 560
WSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKM    561 - 630
KMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA                                        631 - 664
//

Text Mined References (86)

PMID Year Title
26945065 2016 The Sodium Glucose Cotransporter SGLT1 Is an Extremely Efficient Facilitator of Passive Water Transport.
26377793 2015 Transcriptional regulation of NHE3 and SGLT1 by the circadian clock protein Per1 in proximal tubule cells.
26316524 2015 Intracellular Na+ Concentration ([Na+]i) Is Elevated in Diabetic Hearts Due to Enhanced Na+-Glucose Cotransport.
26121582 2015 Expression of SGLT1 in Human Hearts and Impairment of Cardiac Glucose Uptake by Phlorizin during Ischemia-Reperfusion Injury in Mice.
26086341 2015 Identification of phlorizin binding domains in sodium-glucose cotransporter family: SGLT1 as a unique model system.
25936754 2015 An essential role of cAMP response element-binding protein in epidermal growth factor-mediated induction of sodium/glucose cotransporter 1 gene expression and intestinal glucose uptake.
25711084 2014 [The interaction between SGLT1 or GLUT2 glucose transporter and the cytoskeleton in the enterocyte as well as Caco2 cell during hexose absorption].
25600494 2015 A gut microbial metabolite of ginsenosides, compound K, induces intestinal glucose absorption and Na(+) /glucose cotransporter 1 gene expression through activation of cAMP response element binding protein.
24236070 2013 Regulation of glucose transporter expression in human intestinal Caco-2 cells following exposure to an anthocyanin-rich berry extract.
24191006 2013 Functional identification and characterization of sodium binding sites in Na symporters.
More...