Property Summary

NCBI Gene PubMed Count 104
PubMed Score 7.30
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 6.9e-10
group 3 medulloblastoma 1.100 6.6e-04
medulloblastoma, large-cell 1.300 2.4e-05
osteosarcoma 1.872 1.4e-07
ovarian cancer -1.100 4.3e-04
pancreatic ductal adenocarcinoma liver m... -1.039 5.2e-03
psoriasis -1.200 3.7e-04
subependymal giant cell astrocytoma 1.126 3.9e-02

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (36)

AA Sequence

MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDR      1 - 70
VADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLF     71 - 140
KNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELA    141 - 210
LMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEK    211 - 280
IYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS    281 - 350
AYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ                    351 - 404
//

Text Mined References (122)

PMID Year Title