Property Summary

NCBI Gene PubMed Count 99
Grant Count 5
Funding $162,891.74
PubMed Score 6.74
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession P13861 Q16823 Q9BUB1
Symbols PKR2
PRKAR2

Gene

PANTHER Protein Class (2)

PDB

2IZX   2KYG   4ZP3  

 MGI Term (1)

Gene RIF (36)

PMID Text
26687946 Disruption of Snapin-PKR2 interaction did not affect PKR2 signaling, but increased the ligand-induced degradation, implying a role of Snapin in the trafficking of PKR2.
26608815 Prkar2a deficiency predisposes to hematopoietic malignancies in vivo. RIIalpha's likely association with HS and DLBCL was hitherto unrecognized and may lead to better understanding of these rare neoplasms.
26372733 High PK-R2 expression is associated with colorectal cancer.
25916936 we demonstrate that neurochondrin has strong isoform selectivity towards the RIIa subunit of PKA with nanomolar affinity
24755349 Results show that mouse Prkar1a and human PRKAR2A exhibited a dynamic spatio-temporal expression in tooth development, whereas neither human PRKAR1A nor mouse Prkar2a showed their expression in odontogenesis.
24753254 These data demonstrate that some Kallmann syndrome-associated, intracellularly retained mutant PKR2 receptors can be functionally rescued, suggesting a potential treatment strategy for patients bearing such mutations.
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
23942052 while there is no change in type II regulatory (RIIalpha) or catalytic (Calpha) subunit expression, site specific RIIalpha (Ser96) and Calpha (Thr197) phosphorylation are increased in heart failure, as well as expression of type I regulatory subunit (RI)
23362281 Smad4 and the R subunit of the protein kinase A holoenzyme form a functional complex in vivo in response to TGFbeta.
22808067 RIaalpha and RIIaalpha were identified as cCMP-binding proteins.
More...

AA Sequence

MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDR      1 - 70
VADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLF     71 - 140
KNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELA    141 - 210
LMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEK    211 - 280
IYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS    281 - 350
AYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ                    351 - 404
//

Text Mined References (117)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26687946 2016 Snapin interacts with G-protein coupled receptor PKR2.
26608815 2015 Hematopoietic neoplasms in Prkar2a-deficient mice.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26372733 2015 Expression of prokineticin-receptor2(PK-R2) is a new prognostic factor in human colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916936 2015 Neurochondrin is an atypical RII?-specific A-kinase anchoring protein.
24755349 2014 PKA regulatory subunit expression in tooth development.
24753254 2014 Functional rescue of Kallmann syndrome-associated prokineticin receptor 2 (PKR2) mutants deficient in trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...