Property Summary

Ligand Count 32
NCBI Gene PubMed Count 63
PubMed Score 151.09
PubTator Score 60.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.200 4.8e-02
atypical teratoid / rhabdoid tumor 1.300 1.2e-06
glioblastoma 1.200 1.3e-03
non-small cell lung cancer 1.077 1.7e-17
osteosarcoma -1.123 7.1e-04
ovarian cancer 1.100 5.5e-05
posterior fossa group A ependymoma 1.200 2.4e-06
psoriasis 1.300 6.7e-04

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTE      1 - 70
QGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIG     71 - 140
VPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLG    141 - 210
RYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPN    211 - 280
GLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLN    281 - 350
YLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML    351 - 420
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLP    421 - 490
VDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSL    491 - 560
DDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADA    561 - 630
AQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCT    631 - 700
SSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN                                     701 - 737
//

Text Mined References (73)

PMID Year Title