Property Summary

NCBI Gene PubMed Count 59
Grant Count 17
Funding $1,745,225.21
PubMed Score 150.62
PubTator Score 60.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma -1.123 0.001
astrocytoma 1.200 0.048
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.001
non-small cell lung cancer 1.077 0.000
posterior fossa group A ependymoma 1.200 0.000
ovarian cancer 1.100 0.000

Gene RIF (32)

PMID Text
25703587 High glycogen synthase 1 expression is associated with myeloid leukemia.
25487600 Overexpression of GYS1, MIF, and MYC is associated with adverse outcome and poor response to azacitidine in myelodysplastic syndromes and acute myeloid leukemia
25371328 over-expression of muscle glycogen synthase (MGS)was detected in diabetic human kidney
23321478 Data suggest that although COOH-terminal dephosphorylation is likely necessary for GS activation, protein kinase Akt-2- (Akt2)-dependent NH2-terminal dephosphorylation is site for "fine-tuning" insulin-mediated GS activation in skeletal muscle.
23134486 Allosteric regulation and the relationship between phosphorylation and the kinetics of glycogen synthase. [Review]
22403297 The present findings demonstrate that physical inactivity-induced insulin resistance in muscle is associated with lower content/activity of key proteins in glucose transport/phosphorylation and storage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300197 GYS1 regulation by HIF plays a central role in the hypoxic accumulation of glycogen, and hypoxia also upregulates the expression of UTP:glucose-1-phosphate urydylyltransferase (UGP2) and 1,4-alpha glucan branching enzyme (GBE1)
More...

AA Sequence

MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTE      1 - 70
QGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIG     71 - 140
VPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLG    141 - 210
RYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPN    211 - 280
GLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLN    281 - 350
YLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML    351 - 420
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLP    421 - 490
VDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSL    491 - 560
DDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADA    561 - 630
AQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCT    631 - 700
SSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN                                     701 - 737
//

Text Mined References (69)

PMID Year Title
25703587 2015 Pathological glycogenesis through glycogen synthase 1 and suppression of excessive AMP kinase activity in myeloid leukemia cells.
25487600 2015 Overexpression of GYS1, MIF, and MYC is associated with adverse outcome and poor response to azacitidine in myelodysplastic syndromes and acute myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
25371328 2015 Over-expression of muscle glycogen synthase in human diabetic nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165324 2014 Leucine-rich repeat kinase 2 regulates tau phosphorylation through direct activation of glycogen synthase kinase-3?.
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
23321478 2013 Akt2 influences glycogen synthase activity in human skeletal muscle through regulation of NH?-terminal (sites 2 + 2a) phosphorylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23134486 2013 Regulation of glycogen synthase from mammalian skeletal muscle--a unifying view of allosteric and covalent regulation.
More...