Property Summary

NCBI Gene PubMed Count 60
PubMed Score 2926.25
PubTator Score 542.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy -1.319 2.7e-05
adult high grade glioma -1.400 5.9e-03
astrocytic glioma -1.900 4.2e-03
Astrocytoma, Pilocytic -1.400 7.1e-06
Breast cancer 2.000 6.9e-05
cystic fibrosis -1.168 1.6e-05
ependymoma -1.900 8.0e-03
glioblastoma -1.500 9.3e-04
group 3 medulloblastoma -1.500 6.4e-03
invasive ductal carcinoma 2.000 3.7e-02
lung cancer -1.500 8.7e-04
non-small cell lung cancer 1.320 4.2e-09
oligodendroglioma -1.600 1.0e-02
osteosarcoma 1.321 1.7e-05
ovarian cancer 2.100 2.6e-04
primitive neuroectodermal tumor -1.700 5.3e-03
psoriasis -1.200 1.5e-02

 GO Component (2)

 MGI Phenotype (1)

Gene RIF (30)

AA Sequence

MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKR      1 - 70
MEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEA     71 - 140
KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWL    141 - 210
PPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK      211 - 278
//

Text Mined References (59)

PMID Year Title