Property Summary

NCBI Gene PubMed Count 55
Grant Count 253
R01 Count 202
Funding $41,867,202.99
PubMed Score 2740.64
PubTator Score 542.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.900 0.004
ependymoma -1.900 0.008
oligodendroglioma -1.600 0.010
psoriasis -1.600 0.000
osteosarcoma 1.321 0.000
medulloblastoma -2.000 0.000
cystic fibrosis -1.168 0.000
glioblastoma -1.500 0.001
primitive neuroectodermal tumor -1.700 0.005
acute quadriplegic myopathy -1.319 0.000
non-small cell lung cancer 1.320 0.000
lung cancer -1.500 0.001
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.400 0.000
Breast cancer 2.000 0.000
invasive ductal carcinoma 2.000 0.037
ovarian cancer 2.100 0.000

Synonym

Accession P13805 O95472 Q16061 Q5U0E1 TnTs
Symbols ANM
TNT
NEM5
STNT
TNTS

Gene

 MGI Term (1)

Gene RIF (25)

PMID Text
26774798 Three homologous genes have evolved in vertebrates to encode three muscle type-specific TnT isoforms: TNNT1 for slow skeletal muscle TnT, TNNT2 for cardiac muscle TnT, and TNNT3 for fast skeletal muscle TnT.
26296490 Nemaline body myopathy Palestinian patients were found to have a novel mutation in troponin T1.
24781421 Biopsy-proven acute and viral myocarditis is associated with elevated concentrations of hs-TnT.
24625749 troponin T and creatinine kinase isoenzyme (CK-MB) have roles in combined renal and myocardial injuries in asphyxiated infants
24020864 Troponin T1 blood levels had a positive association with increased risk for hypertrophic cardiomyopathy.
23244308 TNNT1 DNA methylation levels were positively correlated with mean HDL particle size, HDL-phospholipid, HDL-apolipoprotein AI, HDL-C and TNNT1 expression levels.
22977240 Human slow skeletal troponin T (HSSTnT) isoforms, despite being homologues of cardiac TnT may display distinct functional properties in muscle regulation.
22448368 analysis of parameters of oxygen-dependent metabolism of neutrophils by NBT test and levels of vWF antigen in the serum can be used for predicting the risk of unfavorable outcome in patients with ACS and normal troponin T
22239123 baseline cTnT levels are higher in patients with MPI evidence of reversible myocardial ischaemia than those without reversible ischaemia
21784424 carotid-femoral pulse wave and office pulse pressure are associated with minimally elevated hsTnT levels in the elderly
More...

AA Sequence

MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKR      1 - 70
MEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEA     71 - 140
KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWL    141 - 210
PPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK      211 - 278
//

Text Mined References (54)

PMID Year Title
26774798 2016 TNNT1, TNNT2, and TNNT3: Isoform genes, regulation, and structure-function relationships.
26296490 2016 Nemaline body myopathy caused by a novel mutation in troponin T1 (TNNT1).
25416956 2014 A proteome-scale map of the human interactome network.
24781421 2014 Diagnostic and prognostic validity of different biomarkers in patients with suspected myocarditis.
24625749 2014 The diagnostic value of both troponin T and creatinine kinase isoenzyme (CK-MB) in detecting combined renal and myocardial injuries in asphyxiated infants.
24020864 2013 Use of a highly-sensitive cardiac troponin I assay in a screening population for hypertrophic cardiomyopathy: a case-referent study.
23244308 2012 Epigenome-wide analysis in familial hypercholesterolemia identified new loci associated with high-density lipoprotein cholesterol concentration.
22977240 2012 The functional properties of human slow skeletal troponin T isoforms in cardiac muscle regulation.
22448368 2011 Markers of inflammation and intracellular metabolism of neutrophils in patients with acute coronary syndrome and normal troponin T levels.
22239123 2012 Cardiac troponin T levels and exercise stress testing in patients with suspected coronary artery disease: the Akershus Cardiac Examination (ACE) 1 study.
More...