Property Summary

NCBI Gene PubMed Count 30
PubMed Score 1179.06
PubTator Score 213.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.300 3.7e-04
Multiple myeloma 1.046 6.0e-03
osteosarcoma -1.609 1.9e-05
ovarian cancer 1.600 2.4e-05
pancreatic ductal adenocarcinoma liver m... -1.033 1.1e-02
psoriasis 2.000 1.9e-05

Synonym

Accession P13798 Q9BQ33 Q9P0Y2 AARE
Symbols APH
OPH
AARE
ACPH
D3S48E
D3F15S2
DNF15S2

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDLERMENIRFCRQYLVF      1 - 70
HDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSALEK     71 - 140
HGPVYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYE    141 - 210
DWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRS    211 - 280
ALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPR    281 - 350
QLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLM    351 - 420
VAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQ    421 - 490
PGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDV    491 - 560
KDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCV    561 - 630
VEAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLL    631 - 700
LYPKSTHALSEVEVESDSFMNAVLWLRTHLGS                                          701 - 732
//

Text Mined References (37)

PMID Year Title