Property Summary

NCBI Gene PubMed Count 63
PubMed Score 165.42
PubTator Score 144.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.67424256086182E-35
non-small cell lung cancer 2798 1.45555327599873E-9
lung cancer 4473 8.26507943326073E-7
ulcerative colitis 2087 1.26450671536948E-4
interstitial cystitis 2299 0.00163523214795945
primary Sjogren syndrome 789 0.00250196681064362
glioblastoma 5572 0.00781865657609291
diabetes mellitus 1663 0.015772537743488
Disease Target Count Z-score Confidence
Cancer 2346 3.033 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.300 0.008
non-small cell lung cancer -1.193 0.000
lung cancer -3.800 0.000
diabetes mellitus -1.900 0.016
interstitial cystitis 2.000 0.002
primary Sjogren syndrome 1.200 0.003
lung carcinoma -3.500 0.000
ulcerative colitis 2.000 0.000

Synonym

Accession P13796 B2R613 B4DUA0 Q5TBN4
Symbols LPL
CP64
PLS2
LC64P
HEL-S-37
L-PLASTIN

Gene

PDB

2D85  

  Ortholog (12)

Gene RIF (31)

PMID Text
26945069 elevated L-plastin expression promotes elongation and reduces protrusion density in cells with relatively lower L-plastin than fascin levels.
26264041 association of SNPs in LCP1 and CTIF with hearing
26148677 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer
25881549 Enhanced nitroxidative stress may results in LPL S-glutathionylation leading to impaired chemotaxis, polarization, and bactericidal activity of human neutrophils.
25191796 The proteins (HSP90b, TSM1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases.
24803550 L-plastin plays an important role in the clustering of NKG2D into lipid rafts, and it participates in NKG2D-mediated inhibition of NK cell chemotaxis.
24438191 expression of L-plastin promotes tumor metastasis and, importantly, that this effect depends on an additionally required phosphorylation of L-plastin
24236012 L-plastin is indispensable for podosome formation and function in macrophages.
24170770 Data suggest that several single-nucleotide polymorphisms (SNPs) of the plastin genes PLS3 and LCP1 could serve as gender- and/or stage-specific molecular predictors of tumor recurrence in stage II/III colorectal cancer as well as therapeutic targets.
24009233 LCP1 is functionally relevant to CXCL12 induced B-cell migration.
More...

AA Sequence

MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRIS      1 - 70
FDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDC     71 - 140
RHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVN    141 - 210
IGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLEN    211 - 280
AGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFV    281 - 350
TATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL    351 - 420
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTL    421 - 490
TLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQ    491 - 560
PGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV       561 - 627
//

Text Mined References (73)

PMID Year Title
26945069 2016 Fascin Rigidity and L-plastin Flexibility Cooperate in Cancer Cell Invadopodia and Filopodia.
26264041 2015 Association of SNPs in LCP1 and CTIF with hearing in 11 year old children: findings from the Avon Longitudinal Study of Parents and Children (ALSPAC) birth cohort and the G-EAR consortium.
26148677 2016 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25881549 2015 L-Plastin S-glutathionylation promotes reduced binding to ?-actin and affects neutrophil functions.
25191796 2014 Potential diagnostic significance of HSP90, ACS/TMS1, and L-plastin in the identification of melanoma.
24803550 2014 L-plastin is involved in NKG2D recruitment into lipid rafts and NKG2D-mediated NK cell migration.
24438191 2014 Metastasis of prostate cancer and melanoma cells in a preclinical in vivo mouse model is enhanced by L-plastin expression and phosphorylation.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...