Property Summary

NCBI Gene PubMed Count 67
PubMed Score 176.65
PubTator Score 144.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Tobacco Use Disorder 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 3.109 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
lung cancer -2.200 1.2e-05
diabetes mellitus -1.900 1.6e-02
glioblastoma 1.300 7.8e-03
interstitial cystitis 2.000 1.6e-03
lung carcinoma -3.500 2.7e-35
non-small cell lung cancer -1.193 1.5e-09
primary Sjogren syndrome 1.200 2.5e-03
ulcerative colitis 2.000 1.3e-04

Protein-protein Interaction (4)

Gene RIF (35)

AA Sequence

MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRIS      1 - 70
FDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDC     71 - 140
RHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVN    141 - 210
IGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLEN    211 - 280
AGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFV    281 - 350
TATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL    351 - 420
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTL    421 - 490
TLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQ    491 - 560
PGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV       561 - 627
//

Text Mined References (78)

PMID Year Title