Property Summary

NCBI Gene PubMed Count 33
PubMed Score 355.88
PubTator Score 43.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (51)

AA Sequence

MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDV      1 - 70
GMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNL     71 - 140
LHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPV    141 - 210
SVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC           211 - 273
//

Text Mined References (35)

PMID Year Title