Property Summary

NCBI Gene PubMed Count 32
Grant Count 7
R01 Count 6
Funding $1,050,947
PubMed Score 344.88
PubTator Score 43.63

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (54)

PMID Text
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
24162774 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
23400868 HLA-DO beta-chain antigens are ubiquitinated by MARCH family E3 ligases 1, 8, and 9.
23222639 results show that HLA-DO inhibits HLA-DM function by acting as a substrate mimic, and the findings also limit the possible functional roles for HLA-DO in antigen presentation
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
More...

AA Sequence

MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDV      1 - 70
GMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNL     71 - 140
LHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPV    141 - 210
SVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC           211 - 273
//

Text Mined References (34)

PMID Year Title
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
23400868 2013 Ubiquitination of HLA-DO by MARCH family E3 ligases.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23222639 2013 HLA-DO acts as a substrate mimic to inhibit HLA-DM by a competitive mechanism.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
17652306 2007 Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.
More...