Property Summary

NCBI Gene PubMed Count 142
PubMed Score 0.00
PubTator Score 2384.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Hypersensitivity 63

Gene RIF (123)

PMID Text
26740600 HLA-DRB4 affects type 1 diabetes risk and islet autoantibodies.
25240755 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
25225671 The study identifies a region of focus for B and T cell responses to IA-2 in HLA-DR4 diabetic patients that may explain HLA associations of IA-2 autoantibodies.
24618287 HLA-DR4 codes for susceptibility to RF+ polyarticular JIA with a six-fold risk.
24505475 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23729440 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23537298 The HLA- DR4 gene was clearly associated with susceptibility to rheumatoid arthritis.
23454623 There was a strong association of aspirin resistant thrombophilia with expression of HLA-DRB4 and HLA-DQA1.
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23152536 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
More...

AA Sequence

MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYN      1 - 70
SDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQH     71 - 140
HNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMM    141 - 210
SPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS                  211 - 266
//

Text Mined References (150)

PMID Year Title
26740600 2016 Next-Generation Sequencing Reveals That HLA-DRB3, -DRB4, and -DRB5 May Be Associated With Islet Autoantibodies and Risk for Childhood Type 1 Diabetes.
25225671 2014 HLA-DR4-associated T and B cell responses to specific determinants on the IA-2 autoantigen in type 1 diabetes.
24618287 2014 HLA-DR typing in polyarticular juvenile idiopathic arthritis: a study from a tertiary care hospital in northern India.
23537298 2013 Study of association between HLA-DR4 and DR53 and autoantibody detection in rheumatoid arthritis.
23454623 2013 Aspirin insensitive thrombophilia: transcript profiling of blood identifies platelet abnormalities and HLA restriction.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22671039 2013 Compound heterozygosity of HLA-DRB3*01:01 and HLA-DRB4*01:01 as a potential predictor of fetal neonatal alloimmune thrombocytopenia.
22531795 2012 No gender differences in the frequencies of HLA-DRB3/B4/B5 heterozygotes in newborns and adults in Koreans.
22041925 2012 CD1d-independent activation of mouse and human iNKT cells by bacterial superantigens.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
More...