Property Summary

NCBI Gene PubMed Count 142
PubMed Score 0.00
PubTator Score 2384.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Hypersensitivity 63

Gene RIF (128)

PMID Text
26740600 HLA-DRB4 affects type 1 diabetes risk and islet autoantibodies.
25240755 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
25225671 The study identifies a region of focus for B and T cell responses to IA-2 in HLA-DR4 diabetic patients that may explain HLA associations of IA-2 autoantibodies.
24618287 HLA-DR4 codes for susceptibility to RF+ polyarticular JIA with a six-fold risk.
24505475 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23729440 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23537298 The HLA- DR4 gene was clearly associated with susceptibility to rheumatoid arthritis.
23454623 There was a strong association of aspirin resistant thrombophilia with expression of HLA-DRB4 and HLA-DQA1.
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
More...

AA Sequence

MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYN      1 - 70
SDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQH     71 - 140
HNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMM    141 - 210
SPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS                  211 - 266
//

Text Mined References (150)

PMID Year Title
26740600 2016 Next-Generation Sequencing Reveals That HLA-DRB3, -DRB4, and -DRB5 May Be Associated With Islet Autoantibodies and Risk for Childhood Type 1 Diabetes.
25225671 2014 HLA-DR4-associated T and B cell responses to specific determinants on the IA-2 autoantigen in type 1 diabetes.
24618287 2014 HLA-DR typing in polyarticular juvenile idiopathic arthritis: a study from a tertiary care hospital in northern India.
23537298 2013 Study of association between HLA-DR4 and DR53 and autoantibody detection in rheumatoid arthritis.
23454623 2013 Aspirin insensitive thrombophilia: transcript profiling of blood identifies platelet abnormalities and HLA restriction.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22671039 2013 Compound heterozygosity of HLA-DRB3*01:01 and HLA-DRB4*01:01 as a potential predictor of fetal neonatal alloimmune thrombocytopenia.
22531795 2012 No gender differences in the frequencies of HLA-DRB3/B4/B5 heterozygotes in newborns and adults in Koreans.
22041925 2012 CD1d-independent activation of mouse and human iNKT cells by bacterial superantigens.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
More...