Property Summary

NCBI Gene PubMed Count 2,525
PubMed Score 0.00
PubTator Score 5085.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Abnormal blistering of the skin 54
Abnormal rapid eye movement sleep 8
Abnormality of vision 40
Amnesia, Transient Global 9
Arthralgia 90
Arthritis 290
Autoimmune Diseases 67
Bipolar Disorder 666
Blister of skin 54
Bullous pemphigoid 18
C-reactive protein increased 15
CREST Syndrome 16
Cataplexy 11
Chest Pain 38
Contracture 96
Contracture of joint 93
Coughing 25
Decreased platelet count 111
Deglutition Disorders 132
Dental caries 164
Diabetes Mellitus, Insulin-Dependent 48
Diffuse Scleroderma 7
Drug allergy 36
Dyspareunia 12
Dyspnea 76
ESR raised 20
Eczema 45
Elevated C-reactive protein level 15
Erythema 58
Erythema Nodosum 3
Exanthema 43
Excessive daytime somnolence 14
Fatigue 182
Fever 138
Flexion contracture 93
Flexion contractures of joints 93
Flushing 60
Gastroesophageal reflux disease 110
Hallucinations 34
Hallucinations, Sensory 33
Heartburn 78
Increase in T cell number 1
Infiltrate of lung 17
Joint swelling 26
Juvenile rheumatoid arthritis 111
Leukopenia 72
Lymphadenopathy 62
Lymphoma 81
Lymphoma, Follicular 18
Lytic lesion 32
Macule 19
Malabsorption 82
Mediastinal lymphadenopathy 10
Membranous glomerulonephritis 13
Mucosal telangiectasiae 14
Muscle Weakness 170
Narcolepsy without cataplexy 4
Narcolepsy-Cataplexy Syndrome 8
Narrow foramen obturatorium 5
Nausea and vomiting 97
Night sweats 3
Oliguria 8
Pulmonary Fibrosis 106
Recurrent infections 48
Rotting teeth 73
Scleroderma, Limited 6
Skin Ulcer 48
Skin bulla 54
Sleeplessness 16
Somnolence 15
Splenomegaly 190
Systemic onset juvenile chronic arthritis 5
Telangiectasia of the skin 39
Thrombocytopenia 197
Uveitis 103
Weight decreased 103
Xerostomia 42
diabetes mellitus 1728
hypopigmented skin patch 59
psoriasis 6694
ulcerative colitis 1819
Disease Target Count P-value
lung carcinoma 2843 3.7e-30

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 2.5e-03
lung carcinoma -2.700 3.7e-30

 Compartment GO Term (0)

 CSPA Cell Line (2)

Gene RIF (2749)

AA Sequence

MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFD      1 - 70
SDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQH     71 - 140
HNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVM    141 - 210
SPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS                  211 - 266
//

Text Mined References (2531)

PMID Year Title