Property Summary

NCBI Gene PubMed Count 2,432
PubMed Score 0.00
PubTator Score 5085.80

Knowledge Summary

Patent

No data available

Synonym

Accession P13760 O19717 O19739 P13759 Q29875 Q30145 Q9GIX9 Q9GIY4 Q9MY13 Q9XRY5
Symbols SS1
DRB1
HLA-DRB
HLA-DR1B

Gene

PDB

2SEB   4IS6   4Y19   4Y1A   3O6F   3T0E   1J8H   1D5M   1D5X   1D5Z   1D6E   4MCY   4MCZ   4MD0   4MD4   4MD5   4MDI   4MDJ  

 Compartment GO Term (0)

Gene RIF (2661)

PMID Text
27534049 Positive association of DRB1*03 allele with Atopic Bronchial Asthma has been found in Uzbek population.
27049564 This study findings indicate a possibly increased prevalence of neuromyelitis optica in Muslim Arabs in Israel with distinct (positive and negative) HLA associations.
27036319 HLA-DRB1*03 is associated with microalbuminuria in type 1 diabetes. HLA-DRB1*04 had no association.
26990204 One of the associated variants was also found to be linked with increased expression of MERTK in monocytes and higher expression of MERTK was associated with either increased or decreased risk of developing MS, dependent upon HLA-DRB1*15:01 status.
26967484 HLA-DRB1 alleles are associated with dermatitis herpetiformis in Chinese population.
26953725 alleles DRB1*01:01, DQ4, DQ7 and DQ8 are considered as susceptible to egg allergy
26919467 HLA-DRB1 variants better accounted for the association between MHC and susceptibility to RA and SLE than did 3 other HLA-DRB variants.
26915265 Cellular misfolded proteins rescued from degradation by MHC class II molecules seem to be involved in autoimmune diseases as a target for autoantibodies. (review)
26901036 HLA-DRB1*04 alleles are associated with pulmonary tuberculosis;the subtype HLA-DRB1*04:11:01 (p = 0.0019; OR = 2.23; 95% CI = 1.34 to 3.70) was associated with susceptibility to disease, while DRB1*04:07:01 (p<0.0001; OR = 0.02; 95% CI = 0.001 to 0.33)to protection.
26844284 the HLA-DRB1* haplotype appeared complementary with current serologic tools to predict good and poor responders in a treat to target strategy.
More...

AA Sequence

MVCLKFPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFD      1 - 70
SDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQH     71 - 140
HNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLT    141 - 210
SPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS                  211 - 266
//

Text Mined References (2440)

PMID Year Title
27534049 2010 [ANALYSIS OF HLA II GENES IN RELATION TO ATOPIC AND NONATOPIC ASTHMA IN AN UZBEK POPULATION].
27049564 2016 Increased occurrence of anti-AQP4 seropositivity and unique HLA Class II associations with neuromyelitis optica (NMO), among Muslim Arabs in Israel.
27036319 2016 HLA-DRB1*03 as a risk factor for microalbuminuria in same duration of type 1 diabetes: a case control study.
26990204 2016 Common and Low Frequency Variants in MERTK Are Independently Associated with Multiple Sclerosis Susceptibility with Discordant Association Dependent upon HLA-DRB1*15:01 Status.
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26953725 2016 Associations between Milk and Egg Allergens and the HLA-DRB1/DQ Polymorphism: A Bioinformatics Approach.
26919467 2016 Imputing Variants in HLA-DR Beta Genes Reveals That HLA-DRB1 Is Solely Associated with Rheumatoid Arthritis and Systemic Lupus Erythematosus.
26915265 2016 [Misfolded proteins complexed with HLA class II molecules are involved in autoimmune diseases as a target for autoantibodies].
26901036 2016 Alleles of HLA-DRB1*04 Associated with Pulmonary Tuberculosis in Amazon Brazilian Population.
26844284 2015 Collagen Specific T-Cell Repertoire and HLA-DR Alleles: Biomarkers of Active Refractory Rheumatoid Arthritis.
More...