Property Summary

NCBI Gene PubMed Count 216
PubMed Score 0.00
PubTator Score 1621.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.430 3.5e-03
active ulcerative colitis 1.086 7.0e-03
astrocytoma 1.900 4.4e-03
Astrocytoma, Pilocytic 1.100 1.6e-05
Becker muscular dystrophy 1.125 2.8e-03
dermatomyositis 1.200 8.1e-03
diabetes mellitus -1.100 1.5e-03
Duchenne muscular dystrophy 1.390 3.1e-07
glioblastoma 1.600 2.4e-03
group 4 medulloblastoma -1.300 4.5e-05
juvenile dermatomyositis 1.625 9.4e-13
limb girdle muscular dystrophy 2I 1.293 2.4e-04
lung adenocarcinoma -1.590 1.2e-05
lung cancer -1.800 3.9e-04
lung carcinoma -1.600 4.3e-21
malignant mesothelioma -1.700 1.5e-07
medulloblastoma, large-cell -1.700 3.9e-06
Multiple myeloma 1.767 2.0e-03
non-small cell lung cancer -1.477 7.9e-15
osteosarcoma -3.090 3.5e-05
ovarian cancer -1.700 1.3e-05
pituitary cancer -1.100 1.1e-03
psoriasis -1.400 2.0e-04
subependymal giant cell astrocytoma 1.770 1.7e-03

Gene RIF (229)

AA Sequence

MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRA      1 - 70
PWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYD     71 - 140
GKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHV    141 - 210
THHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC    211 - 280
HVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSA    281 - 350
QGSESHSL                                                                  351 - 358
//

Text Mined References (219)

PMID Year Title