Property Summary

NCBI Gene PubMed Count 201
PubMed Score 0.00
PubTator Score 1621.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.767 0.002
malignant mesothelioma -1.700 0.000
psoriasis -1.400 0.000
glioblastoma 2.300 0.000
osteosarcoma -3.090 0.000
astrocytoma 2.000 0.002
medulloblastoma, large-cell -1.700 0.000
Duchenne muscular dystrophy 1.390 0.000
limb girdle muscular dystrophy 2I 1.293 0.000
Becker muscular dystrophy 1.125 0.003
juvenile dermatomyositis 1.879 0.000
non-small cell lung cancer -1.477 0.000
lung cancer -4.200 0.000
active Crohn's disease 1.430 0.003
active ulcerative colitis 1.086 0.007
diabetes mellitus -1.100 0.001
group 4 medulloblastoma -1.300 0.000
pilocytic astrocytoma 1.100 0.000
subependymal giant cell astrocytoma 1.770 0.002
lung adenocarcinoma -1.590 0.000
lung carcinoma -1.700 0.000
ovarian cancer 2.300 0.000
pituitary cancer -1.100 0.001
dermatomyositis 1.500 0.004

Synonym

Accession P13747 Q30169 Q9BT83 Q9GIY7 Q9GIY8
Symbols QA1
HLA-6.2

Gene

PDB

3BZE   3CDG   3CII   2ESV   1KPR   1KTL   1MHE   3AM8   3BZF  

Gene RIF (233)

PMID Text
26828202 HLA-E is capable of presenting a highly conserved peptide from HIV-1 capsid (AISPRTLNA) that is not recognized by NKG2A/CD94.
26596885 the promoter region of the HLA-E gene presents few and rare variable sites in Brazilian population sample.
26552660 Functional differences and the immunological impact of HLA-E allelic variant Arg107Gly
26382247 HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire
26310830 HLA-E molecules traffic differently from the HLA-class I molecules and can play a fundamental role in the protection against intracellular pathogens and susceptibility to several diseases.
26307125 The results derived from this study imply that HLA-E polymorphisms may influence RA susceptibility and affect clinical outcome of anti-TNF therapy in female RA patients.
26302084 this study suggests that minor histocompatibility antigens presented by HLA-E can represent an additional risk factor following lung transplantation.
26261988 These results indicate that E*01:01 is a novel protective genetic factor in EBV-associated cHL and support a role for HLA-E recognition on the control of EBV infection and lymphomagenesis.
26090591 over-expression of HLA-E is associated with melanoma
25982269 Monoclonal antibodies to HLA-E bind epitopes carried by unfolded beta2 m-free heavy chains.
More...

AA Sequence

MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRA      1 - 70
PWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYD     71 - 140
GKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHV    141 - 210
THHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC    211 - 280
HVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSA    281 - 350
QGSESHSL                                                                  351 - 358
//

Text Mined References (204)

PMID Year Title
26828202 2016 A Conserved HIV-1-Derived Peptide Presented by HLA-E Renders Infected T-cells Highly Susceptible to Attack by NKG2A/CD94-Bearing Natural Killer Cells.
26596885 2016 Low variability at the HLA-E promoter region in the Brazilian population.
26552660 2016 The diversity of the HLA-E-restricted peptide repertoire explains the immunological impact of the Arg107Gly mismatch.
26382247 2015 HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire.
26310830 2016 Regulation and trafficking of the HLA-E molecules during monocyte-macrophage differentiation.
26307125 2015 Polymorphisms within the human leucocyte antigen-E gene and their associations with susceptibility to rheumatoid arthritis as well as clinical outcome of anti-tumour necrosis factor therapy.
26302084 2015 The Presence of HLA-E-Restricted, CMV-Specific CD8+ T Cells in the Blood of Lung Transplant Recipients Correlates with Chronic Allograft Rejection.
26261988 2015 HLA Allele E*01:01 Is Associated with a Reduced Risk of EBV-Related Classical Hodgkin Lymphoma Independently of HLA-A*01/*02.
26090591 2015 The Monospecificity of Novel Anti-HLA-E Monoclonal Antibodies Enables Reliable Immunodiagnosis, Immunomodulation of HLA-E, and Upregulation of CD8+ T Lymphocytes.
25982269 2015 Monoclonal antibodies to HLA-E bind epitopes carried by unfolded ?2 m-free heavy chains.
More...