Property Summary

NCBI Gene PubMed Count 1,220
PubMed Score 4123.76
PubTator Score 2865.77

Knowledge Summary

Patent

No data available

Expression

PDB (15)

Gene RIF (1253)

AA Sequence

MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME      1 - 70
PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQD     71 - 140
AYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPK    141 - 210
THMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASS    281 - 350
DSAQGSDVSLTACKV                                                           351 - 365
//

Text Mined References (1226)

PMID Year Title