Property Summary

NCBI Gene PubMed Count 65
PubMed Score 14.71
PubTator Score 164.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (26)

AA Sequence

MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKK      1 - 70
DGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN     71 - 140
INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA    141 - 210
HCLRRLPFICSY                                                              211 - 222
//

Text Mined References (69)

PMID Year Title