Property Summary

NCBI Gene PubMed Count 65
PubMed Score 13.16
PubTator Score 164.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P13727 A6XMW0 B2R5I1 P81448 Q14227 Q6ICT2 BMPG
Symbols MBP
BMPG
MBP1
proMBP

Gene

PDB

1H8U   2BRS   4QXX  

Gene RIF (26)

PMID Text
25266917 free protein in nasal mucus can be used as a biomarker to diagnose chronic rhinosinusitis
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
24112102 Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-beta1.
23033876 During pregnancy, the proform of eosinophil major basic protein-angiotensinogen constitutes the major form in late pregnancy.
20977431 Combinations of respiratory syncytial virus and MBP synergistically induced cell death in pulmonary alveolar epithelial cells (A549).
20849415 novel transcript was alternatively transcribed from intron III of the ENO1 gene and was feasible for MBP-1 production
20237496 Observational study of gene-disease association. (HuGE Navigator)
19626619 The proMBP is a novel first trimester serum marker for adverse pregnancy outcome.
19398958 addition to granule-stored MBP, even unstimulated eosinophils contained appreciable amounts of MBP within secretory vesicles
19039208 The significantly elevated levels of proMBP in myelofibrosis patients implies that proMBP could be an important stromal cytokine in bone marrow fibrosis.
More...

AA Sequence

MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKK      1 - 70
DGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN     71 - 140
INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA    141 - 210
HCLRRLPFICSY                                                              211 - 222
//

Text Mined References (69)

PMID Year Title
25266917 2015 An immunologic test for chronic rhinosinusitis based on free intranasal eosinophilic major basic protein.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24112102 2013 Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-?1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23033876 2013 Formation of high-molecular-weight angiotensinogen during pregnancy is a result of competing redox reactions with the proform of eosinophil major basic protein.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20977431 2011 Effects of respiratory syncytial virus infection and major basic protein derived from eosinophils in pulmonary alveolar epithelial cells (A549).
20849415 2010 MBP-1 is efficiently encoded by an alternative transcript of the ENO1 gene but post-translationally regulated by proteasome-dependent protein turnover.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...