Property Summary

Ligand Count 74
NCBI Gene PubMed Count 559
PubMed Score 11133.87
PubTator Score 473.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (24)

Disease log2 FC p
Atopic dermatitis -1.600 1.2e-04
atypical teratoid/rhabdoid tumor -1.100 3.5e-02
Barrett's esophagus 1.400 3.1e-02
Breast cancer -2.300 1.4e-10
breast carcinoma -1.300 8.5e-23
chronic rhinosinusitis -1.018 4.8e-02
group 3 medulloblastoma -2.600 4.3e-05
interstitial lung disease -1.600 1.2e-02
intraductal papillary-mucinous adenoma (... 1.200 2.3e-02
invasive ductal carcinoma -1.800 1.3e-03
lung adenocarcinoma -1.047 2.8e-02
lung cancer -2.800 3.6e-06
lung carcinoma -2.900 2.8e-33
medulloblastoma, large-cell -2.800 7.9e-06
nasopharyngeal carcinoma -2.800 2.0e-06
ovarian cancer -1.400 2.3e-03
pancreatic cancer 1.400 6.2e-03
pituitary cancer -2.100 4.4e-04
primary pancreatic ductal adenocarcinoma 1.185 2.9e-02
primitive neuroectodermal tumor -1.400 2.3e-02
psoriasis -1.700 1.7e-06
spina bifida -2.147 4.1e-02
tuberculosis -3.200 1.1e-04
ulcerative colitis 2.800 6.7e-08

Protein-protein Interaction (3)

Gene RIF (516)

AA Sequence

METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQI      1 - 70
STKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNL     71 - 140
GQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLID    141 - 210
VDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKA    211 - 280
GVGQSWKENSPLNVS                                                           281 - 295
//

Text Mined References (560)

PMID Year Title