Property Summary

NCBI Gene PubMed Count 525
Grant Count 1,079
R01 Count 570
Funding $212,370,121.92
PubMed Score 10795.33
PubTator Score 473.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (75)

Disease Z-score Confidence
Disseminated intravascular coagulation 32 7.275 3.6
Thrombocytopenia 105 6.379 3.2
Antiphospholipid syndrome 18 5.781 2.9
Coronary artery disease 240 5.643 2.8
Pulmonary Embolism 45 5.576 2.8
Factor VII deficiency 5 5.215 2.6
Cerebrovascular disease 231 5.207 2.6
Cancer 2,346 5.133 2.6
Atherosclerosis 275 5.125 2.6
Factor XI deficiency 9 5.113 2.6
Hemophilia B 11 5.101 2.6
Lupus erythematosus 80 5.095 2.5
Von Willebrand's disease 19 5.058 2.5
Factor XII deficiency 11 4.934 2.5
Heart disease 279 4.888 2.4
Liver disease 219 4.737 2.4
Factor VIII deficiency 10 4.669 2.3
Vitamin K deficiency hemorrhagic disease 11 4.642 2.3
Factor X deficiency 5 4.625 2.3
Factor V Deficiency 7 4.545 2.3
Kidney disease 396 4.522 2.3
Anemia 252 4.467 2.2
Hypertension 287 4.344 2.2
Connective tissue disease 59 4.224 2.1
Respiratory failure 30 4.069 2.0
Factor XIII deficiency 7 4.03 2.0
Phlebitis 3 3.842 1.9
Prothrombin deficiency 3 3.745 1.9
diabetes mellitus 1,663 3.736 1.9
Crimean-Congo hemorrhagic fever 10 3.733 1.9
Peripheral vascular disease 90 3.69 1.8
Protein S deficiency 5 3.631 1.8
Pneumonia 133 3.429 1.7
Placental abruption 15 3.37 1.7
Leukopenia 42 3.334 1.7
Purpura 17 3.324 1.7
Thrombotic thrombocytopenic purpura 14 3.249 1.6
Dengue disease 19 3.247 1.6
Vasculitis 64 3.2 1.6
Glanzmann's thrombasthenia 21 3.194 1.6
Protein C deficiency 19 3.114 1.6
Brain disease 83 3.054 1.5
Sickle cell anemia 35 3.01 1.5
Acute Promyelocytic Leukemia 31
Atopic dermatitis 944
Barrett's esophagus 183
Breast cancer 3,094
Liver Cirrhosis 101
Mammary Neoplasms 410
Myocardial Ischemia 169
Nephrotic Syndrome 48
Purpura, Thrombotic Thrombocytopenic 4
Thrombosis 42
Venous Thrombosis 21
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
chronic rhinosinusitis 512
group 3 medulloblastoma 2,254
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
ovarian cancer 8,484
pancreatic cancer 2,300
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
spina bifida 1,064
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease -1.600 0.012
Barrett's esophagus 1.400 0.031
psoriasis -2.300 0.000
group 3 medulloblastoma -2.600 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.400 0.023
Atopic dermatitis -1.600 0.000
tuberculosis -3.200 0.000
primary pancreatic ductal adenocarcinoma 1.185 0.029
intraductal papillary-mucinous adenoma (... 1.200 0.023
lung cancer -3.600 0.000
atypical teratoid/rhabdoid tumor -1.100 0.035
nasopharyngeal carcinoma -2.800 0.000
lung adenocarcinoma -1.047 0.028
lung carcinoma -2.900 0.000
breast carcinoma -1.300 0.000
spina bifida -2.147 0.041
Breast cancer -2.300 0.000
invasive ductal carcinoma -1.800 0.001
ulcerative colitis 2.800 0.000
ovarian cancer -1.400 0.002
pituitary cancer -2.100 0.000
chronic rhinosinusitis -1.018 0.048
pancreatic cancer 1.400 0.006

Synonym

Accession P13726 D3DT47 Q6FHG2 Q86WH4 TF
Symbols TF
TFA
CD142

Gene

F3

PDB

1AHW   1BOY   1DAN   1FAK   1J9C   1JPS   1NL8   1O5D   1TFH   1UJ3   1W0Y   1W2K   1WQV   1WSS   1WTG   1WUN   1WV7   1Z6J   2A2Q   2AEI   2AER   2B7D   2B8O   2C4F   2CEF   2CEH   2CEZ   2CFJ   2EC9   2F9B   2FIR   2FLB   2FLR   2HFT   2PUQ   2ZP0   2ZWL   2ZZU   3ELA   3TH2   3TH3   3TH4   4IBL   4M7L   4YLQ   4Z6A   4ZMA  

Gene RIF (483)

PMID Text
27057091 The findings of the study show an increased expression of tissue factor in the lesional and perilesional skin of patients with bullous pemphigoid. The expression of TF was not observed in biopsies from healthy people and dermatitis herpetiformis patients.
26797521 We conclude that API M358R inhibits FVIIa by forming inhibitory complexes of the serpin type more rapidly than AT in the absence of heparin.
26791271 This study suggests that ROCK/YAP/Egr-1 signaling regulates tissue factor expression after stimulation with lipopolysaccharide in endothelial cells.
26731648 Data indicate that IGF-binding protein 3 (IGFBP3) and F3 gene expression levels in formalin fixed paraffin embedded (FFPE) prostate cancer tissue would provide an improved survival prediction for prostate cancer patients.
26694616 Data suggest that allosteric regulation of FVIIa activity by tissue factor/thromboplastin binding appear to involve direct interaction with FVIIa active site, stabilizing segment 215-217, activating loop 3, and leading to enhanced FVIIa activity.
26631725 Activation of P2Y2R increased TF promoter activity and mRNA expression in coronary artery endothelial cells.
26504080 B-Raf(V600E) mutation in metastatic melanoma cells up-regulated tissue factor expression on cell membranes and promoted thrombin production
26471500 expression by myeloid cells affects macrophage differentiation, and regulate Mycobacterium tuberculosis growth
26408927 TF plays more fundamental roles in cancer biology. TF regulates tumor cell dormancy, is associated with cancer stem cell behavior, epithelial-to-mesenchymal transition, and dictates establishment of the tumor cell premetastatic niche.
26408926 Clinical Significance of Tissue Factor-Exposing Microparticles in Arterial and Venous Thrombosis.
More...

AA Sequence

METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQI      1 - 70
STKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNL     71 - 140
GQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLID    141 - 210
VDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKA    211 - 280
GVGQSWKENSPLNVS                                                           281 - 295
//

Text Mined References (526)

PMID Year Title
27057091 2015 Tissue Factor in Dermatitis Herpetiformis and Bullous Pemphigoid: Link between Immune and Coagulation System in Subepidermal Autoimmune Bullous Diseases.
26797521 2016 The M358R variant of ?(1)-proteinase inhibitor inhibits coagulation factor VIIa.
26791271 2016 Yes-associated protein (YAP) signaling regulates lipopolysaccharide-induced tissue factor expression in human endothelial cells.
26731648 2016 Improving the Prediction of Prostate Cancer Overall Survival by Supplementing Readily Available Clinical Data with Gene Expression Levels of IGFBP3 and F3 in Formalin-Fixed Paraffin Embedded Core Needle Biopsy Material.
26694616 2016 Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
26504080 2016 Mutant B-Raf(V600E) Promotes Melanoma Paracellular Transmigration by Inducing Thrombin-mediated Endothelial Junction Breakdown.
26471500 2016 Tissue factor expression by myeloid cells contributes to protective immune response against Mycobacterium tuberculosis infection.
26408927 2015 Tissue Factor: Old and New Links with Cancer Biology.
26408926 2015 Clinical Significance of Tissue Factor-Exposing Microparticles in Arterial and Venous Thrombosis.
More...