Property Summary

NCBI Gene PubMed Count 134
PubMed Score 421.52
PubTator Score 379.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.700 1.1e-03
hepatocellular carcinoma -1.700 4.5e-06
lung adenocarcinoma 1.100 4.0e-03
non-small cell lung cancer -1.059 1.7e-07
ovarian cancer 1.100 2.9e-02
psoriasis 3.900 1.9e-55
tuberculosis -2.200 7.4e-04
ulcerative colitis 1.500 1.3e-02

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (109)

AA Sequence

MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKL      1 - 70
REHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMAR     71 - 140
PNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFS    141 - 210
KWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR                                211 - 252
//

Text Mined References (135)

PMID Year Title