Property Summary

NCBI Gene PubMed Count 125
Grant Count 163
R01 Count 94
Funding $11,006,807.94
PubMed Score 400.07
PubTator Score 379.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.700 0.001
hepatocellular carcinoma -1.700 0.000
tuberculosis -2.200 0.001
non-small cell lung cancer -1.059 0.000
lung adenocarcinoma 1.100 0.004
ulcerative colitis 1.500 0.013
ovarian cancer 1.100 0.029
psoriasis 3.900 0.000

Synonym

Accession P13725 Q6FHP8 Q9UCP6 OSM
Symbols

Gene

OSM

PDB

1EVS  

Gene RIF (99)

PMID Text
26399567 Nucleolin stabilizes oncostatin-M mRNA by binding to a GC-rich element in its 3'UTR.
26355153 administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation
26311783 Oncostatin M regulates neuronal function and confers neuroprotectin in an animal model of ischemic stroke.
26304992 OSM expression in osteoblasts increases in response to Osteopontin-induced inflammation in vitro.
26198770 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25954856 we demonstrated that recombinant human OSM (rhOSM) promoted tumor angiogenesis in EC cell lines by activating STAT3 (signal transducer and activator of transcription 3) and enhanced both cell migration and cell inva
25849622 Oncostatin M can regulate airway smooth muscle responses alone or in synergy with IL-17A.
25845347 The Notch signaling pathway was found to be one of the signaling pathways that inhibit OSM-induced MC3T3-E1 cell proliferation and differentiation.
25840724 OSM promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease.
25804939 In patients with diabetes, bone marrow plasma OSM levels were higher and correlated with the bone marrow to peripheral blood stem cell ratio.
More...

AA Sequence

MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKL      1 - 70
REHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMAR     71 - 140
PNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFS    141 - 210
KWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR                                211 - 252
//

Text Mined References (126)

PMID Year Title
26399567 2016 Stabilization of Oncostatin-M mRNA by Binding of Nucleolin to a GC-Rich Element in Its 3'UTR.
26355153 2015 Fstl1 Promotes Asthmatic Airway Remodeling by Inducing Oncostatin M.
26311783 2015 Oncostatin M Confers Neuroprotection against Ischemic Stroke.
26304992 2015 Osteopontin Promotes Oncostatin M Production in Human Osteoblasts: Implication of Rheumatoid Arthritis Therapy.
26198770 2015 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25954856 2015 Oncostatin M activates STAT3 to promote endometrial cancer invasion and angiogenesis.
25849622 2015 Regulation of IL-17A responses in human airway smooth muscle cells by Oncostatin M.
25845347 2015 OSM is overexpressed in knee osteoarthritis and Notch signaling is involved in the effects of OSM on MC3T3-E1 cell proliferation and differentiation.
25840724 2015 Oncostatin M promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease.
25804939 2015 Bone Marrow Macrophages Contribute to Diabetic Stem Cell Mobilopathy by Producing Oncostatin M.
More...