Property Summary

NCBI Gene PubMed Count 114
Grant Count 128
R01 Count 88
Funding $22,020,814.29
PubMed Score 979.85
PubTator Score 784.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P13716 A8K375 B2R6F2 Q16870 Q16871 Q9BVQ9 ALADH
Symbols PBGS
ALADH

Gene

PANTHER Protein Class (2)

PDB

1E51   1PV8   5HMS   5HNR  

 GWAS Trait (1)

Gene RIF (100)

PMID Text
26701682 Results show statistically significant association between the maternal ALAD G177C polymorphism and placental lead levels.
26275098 Blood lead level affected ALAD but not GPx activities, and these were not modulated by polymorphisms in ALAD and GPx genes.
26261627 Maternal ALAD gene polymorphism can affect early neonatal neurobehavioral development by influencing the blood lead level.
25963508 Study reveals relationship between ALAD genetic polymorphisms and basic lead toxicological parameters in occupationally exposed workers.
25820613 Genetic variation of ALAD is associated with blood lead level.
25528913 The ff carriers in VDR FokI polymorphism were more susceptible to the effect of lead on the balance system, while other VDR or ALAD genotypes did not significantly modify the effect.
25514583 This study showed that ALAD2 and hPEPT2*2 may be valuable markers of risk, and indicate novel mechanisms of lead-induced neurotoxicity
25460652 The results indicate that the ALAD1-2/2-2 genotype may have a protective effect in terms of urinary aminolevulinic acid for environmentally lead exposed boys.
24855033 This study investigated the delta-aminolevulinate dehydratase (delta-ALA-D) activity in whole blood as well as the parameters of oxidative stress, in lung cancer.
24631795 Report the effect of ALAD polymorphism on hematopoietic, hepatic and renal toxicity from lead in occupational exposure workers.
More...

AA Sequence

MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVE      1 - 70
EGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGA     71 - 140
FRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRD    141 - 210
AAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSG    211 - 280
EFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE                        281 - 330
//

Text Mined References (121)

PMID Year Title
26701682 2016 Association between delta-aminolevulinic acid dehydratase polymorphism and placental lead levels.
26275098 2015 Effects of Lead Exposure and Genetic Polymorphisms on ALAD and GPx Activities in Brazilian Battery Workers.
26261627 2015 Relationship among maternal blood lead, ALAD gene polymorphism and neonatal neurobehavioral development.
25963508 2015 The relationship between selected VDR, HFE and ALAD gene polymorphisms and several basic toxicological parameters among persons occupationally exposed to lead.
25820613 2015 Genome-wide association study of blood lead shows multiple associations near ALAD.
25528913 2014 Disturbance of posture in children with very low lead exposure, and modification by VDR FokI genotype.
25514583 ?-Aminolevulinic acid dehydratase single nucleotide polymorphism 2 (ALAD2) and peptide transporter 2*2 haplotype (hPEPT2*2) differently influence neurobehavior in low-level lead exposed children.
25460652 2015 Delta-aminolevulinic acid dehydratase (ALAD) polymorphism in lead exposed Bangladeshi children and its effect on urinary aminolevulinic acid (ALA).
24855033 2014 ?-Aminolevulinate dehydratase activity in lung cancer patients and its relationship with oxidative stress.
24631795 2014 Investigation of delta-aminolevulinic acid dehydratase polymorphism affecting hematopoietic, hepatic and renal toxicity from lead in Han subjects of southwestern China.
More...