Property Summary

NCBI Gene PubMed Count 117
PubMed Score 1068.56
PubTator Score 784.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Porphyria 10 0.0 5.0
Disease Target Count
acute porphyria 1

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.399 1.8e-04
aldosterone-producing adenoma -1.385 2.2e-02
atypical teratoid/rhabdoid tumor -1.200 4.0e-08
cutaneous lupus erythematosus -1.100 1.4e-03
gastric carcinoma -1.200 3.4e-02
invasive ductal carcinoma -1.100 1.3e-03
malignant mesothelioma -1.700 1.3e-07
medulloblastoma -1.100 5.4e-06
medulloblastoma, large-cell -1.300 3.6e-05
non primary Sjogren syndrome sicca 1.400 1.4e-02
osteosarcoma -2.798 1.6e-06
ovarian cancer -2.000 1.5e-12
pancreatic ductal adenocarcinoma liver m... -1.308 1.2e-02
tuberculosis 1.200 2.9e-06
ulcerative colitis -1.300 7.0e-08

 GWAS Trait (1)

Gene RIF (102)

AA Sequence

MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVE      1 - 70
EGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGA     71 - 140
FRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRD    141 - 210
AAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSG    211 - 280
EFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE                        281 - 330
//

Text Mined References (125)

PMID Year Title