Property Summary

NCBI Gene PubMed Count 89
Grant Count 136
R01 Count 59
Funding $30,441,475.48
PubMed Score 549.96
PubTator Score 400.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -4.000 0.034
ovarian cancer -1.800 0.000

Synonym

Accession P13693 B2R7E5 Q6YLS2 Q7Z4J4 Q8TBK7 Q96EE2 Q9UC70 TCTP
Symbols HRF
p02
p23
TCTP

Gene

PDB

1YZ1   2HR9   3EBM   4Z9V  

Gene RIF (64)

PMID Text
26425551 These data may suggest an involvement of translationally controlled tumor protein in normal physiology and carcinogenesis.
26328748 Downregulation of the expression of TCTP inhibits the migration and invasion of glioma cells.
25936523 Results demonstrate that TCTP mRNA translation is regulated by signalling through the PI3-K/Akt/mTORC1 pathway in neoplasms.
25779659 High phospho-TCTP expression levels are associated with aggressive breast cancer.
25423047 analysis of how TCTP-PTD penetrates A549 human lung cancer cell membranes and promotes protein internalization
25396429 TCTP binds to hemin and functions as a "buffer protein", controlling cellular homeostasis.
25363345 High HRF expression is associated with non-Hodgkin lymphomas.
25277244 Targeting Hsp27 interaction with TCTP, a partner protein identified in a genetic screen, increases therapy sensitivity, and could decrease or abolish toxicity to normal cells.
25270224 Data indicate that Tanshinone IIA (Tan-IIA)T upregulated the protein expression of CHOP and Bax, but downregulated the protein expression of BiP, TCTP, Mcl-1 and Bcl-xL.
25263704 osteoclastogenic activity of translationally-controlled tumor protein (TCTP) with reciprocal repression of p21
More...

AA Sequence

MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV      1 - 70
DIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENM     71 - 140
NPDGMVALLDYREDGVTPYMIFFKDGLEMEKC                                          141 - 172
//

Text Mined References (95)

PMID Year Title
26425551 2015 Expression of Translationally Controlled Tumor Protein in Human Kidney and in Renal Cell Carcinoma.
26328748 2015 RNA interference?mediated knockdown of translationally controlled tumor protein induces apoptosis, and inhibits growth and invasion in glioma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936523 2015 Growth-factor dependent expression of the translationally controlled tumour protein TCTP is regulated through the PI3-K/Akt/mTORC1 signalling pathway.
25779659 2015 Phospho-TCTP as a therapeutic target of Dihydroartemisinin for aggressive breast cancer cells.
25423047 2015 Cellular uptake mechanism of TCTP-PTD in human lung carcinoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25396429 2014 Ligand binding reveals a role for heme in translationally-controlled tumor protein dimerization.
25363345 2015 Histamine-releasing factor/translationally controlled tumor protein plays a role in induced cell adhesion, apoptosis resistance and chemoresistance in non-Hodgkin lymphomas.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
More...