Property Summary

NCBI Gene PubMed Count 96
PubMed Score 612.63
PubTator Score 400.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -3.700 2.8e-02
ovarian cancer -1.300 2.3e-05

Gene RIF (70)

AA Sequence

MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV      1 - 70
DIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENM     71 - 140
NPDGMVALLDYREDGVTPYMIFFKDGLEMEKC                                          141 - 172
//

Text Mined References (102)

PMID Year Title