Property Summary

NCBI Gene PubMed Count 186
PubMed Score 343.34
PubTator Score 364.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.97252368223981E-7
pancreatic cancer 2300 4.84239746225621E-7
malignant mesothelioma 3163 4.88492511434857E-7
osteosarcoma 7933 2.32667922440573E-6
lung adenocarcinoma 2714 8.45053576105576E-5
medulloblastoma, large-cell 6234 8.97653608597941E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.63985024914213E-4
colon cancer 1475 0.00149417697392808
psoriasis 6685 0.00181799973517781
lung cancer 4473 0.00190568234329791
pituitary cancer 1972 0.00193675731554735
cystic fibrosis 1670 0.00249076341293757
mucosa-associated lymphoid tissue lymphoma 480 0.00523218874052074
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00674598926425313
chronic rhinosinusitis 512 0.0112628487593208
non primary Sjogren syndrome sicca 840 0.0128464456307274
Waldenstrons macroglobulinemia 765 0.0196235078977738
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0210312892511685
active Crohn's disease 918 0.0364099021583493
primary pancreatic ductal adenocarcinoma 1271 0.0373335368527072
head and neck cancer 270 0.0493272383500839
Disease Target Count Z-score Confidence
Cancer 2346 4.102 2.1
Gonorrhea 14 3.485 1.7

Expression

Gene

PDB

2GK2   4QXW   4WHD   5DZL  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA Inparanoid
Horse OMA Inparanoid

Gene RIF (155)

PMID Text
27074014 Osteosarcoma patients with higher CEACAM1 had relatively lower survival compared to those with low CEACAM1 and high serum CEACAM1 level was an independent prognostic factor for osteosarcoma
26688824 serum CEACAM1 is elevated over time in progressive melanoma patients who fail to respond to immunotherapy as opposed to responders and stable disease patients.
26653024 CEACAM1 might play an important role in ovarian tumor progression, especially in tumor metastasis
26646010 Collectively, these data suggest that vIL-6 modulates endothelial cell migration by upregulating the expression of cellular factors, including CEACAM1.
26343926 Serum concentrations of CEACAM1 may serve as a useful indicator for the presence of breast cancer
26341981 Taken together, our results demonstrate a systematic down-regulation of CEACAM1 in breast cancer and suggest that a strategy to restore CEACAM1 expression may be helpful for the treatment of breast cancer.
26301891 an MITF-CEACAM1 axis is suggested as a potential determinant of melanoma progression.
26238781 Ceacam1L acts as a crucial factor in glioblastoma-initiating cell maintenance and tumorigenesis by activating c-Src/STAT3 signaling. Monomers of the cytoplasmic domain of Ceacam1L bound to c-Src and STAT3 and induced their phosphorylation.
26107193 High Carcinoembryonic Antigen expression is associated with colon and stomach cancer.
26081722 CEACAM1 mediates bacterial adherence and transcellular transcytosis.
More...

AA Sequence

MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKG      1 - 70
ERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDT    141 - 210
GPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQS    211 - 280
TQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCST    281 - 350
NDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP    351 - 420
QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNE    421 - 490
VTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ                                      491 - 526
//

Text Mined References (190)

PMID Year Title
27074014 2016 Serum CEACAM1 Level Is Associated with Diagnosis and Prognosis in Patients with Osteosarcoma.
26688824 2015 Serum CEACAM1 Elevation Correlates with Melanoma Progression and Failure to Respond to Adoptive Cell Transfer Immunotherapy.
26653024 2016 Carcinoembryonic antigen-related cell adhesion molecule 1 is expressed and as a function histotype in ovarian tumors.
26646010 2015 Kaposi's Sarcoma-Associated Herpesvirus Interleukin-6 Modulates Endothelial Cell Movement by Upregulating Cellular Genes Involved in Migration.
26343926 2015 Assay of serum CEACAM1 as a potential biomarker for breast cancer.
26341981 2015 Down-regulation of CEACAM1 in breast cancer.
26301891 2015 MITF is a critical regulator of the carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) in malignant melanoma.
26238781 2015 Ceacam1L Modulates STAT3 Signaling to Control the Proliferation of Glioblastoma-Initiating Cells.
26107193 2015 Comparative Study of Carcinoembryonic Antigen Tumor Marker in Stomach and Colon Cancer Patients in Khyber Pakhtunkhwa.
26081722 2015 Roles of CEACAM1 in cell communication and signaling of lung cancer and other diseases.
More...